(data stored in ACNUC7421 zone)

EMBL: CP001630.PE249

CP001630.PE249       Location/Qualifiers
FT   CDS_pept        complement(277624..277872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34223"
FT                   /db_xref="GOA:C6WF91"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34223.1"
FT                   /translation="MTAWFVIAVPIVIMFFALFMERVEARLRHVAVQEDEVEEFLESAR
FT                   PDEVKALYGHGIGRALELFRLRRFGGRSKNLRSRPRR"
     atgactgcct ggttcgtcat cgccgttccg atcgtgatca tgttcttcgc gctcttcatg        60
     gagcgcgtcg aagcccgcct gcggcacgtc gccgtgcagg aggacgaggt cgaggagttc       120
     ctcgagtccg cgcgccccga cgaggtcaag gcgctctacg ggcacggcat cggccgcgcg       180
     ctggagctgt tccgcctgcg ccggttcggc ggtcgctcga agaacctgcg gtcgcgcccc       240
     cgccgctag                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page