(data stored in ACNUC7421 zone)

EMBL: CP001630.PE25

CP001630.PE25        Location/Qualifiers
FT   CDS_pept        complement(27955..29379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0025"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: tgr:Tgr7_0952 protein
FT                   phosphatase 2C-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33999"
FT                   /db_xref="GOA:C6WCH8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH8"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ACU33999.1"
FT                   /translation="MTLVLRYAARSDRGLVRQNNQDSVYAGPRLLALADGMGGHAAGEV
FT                   ASKVVIAALAPLDDDEPGDDLLGQLRDAVISGNGAISELVQSDPDLDGMGTTLTAVLFA
FT                   GTRLGMVHIGDSRAYMMRNGTFSQITHDDTFVQSLIDEGRITEEEAATHPQRSLLLRAL
FT                   TGHEVEPRLMVREARPGDRYLLCSDGLSGVVTLETLDEAIRIPDPQACADRMIELALKG
FT                   GGPDNVTVVVADVVDVDFGENAPIVGGAAGDGGDDPPPPDSPASRASSITGPRPAPPRQ
FT                   EQPPPPQQDPKRERKGKLKALALVVLVLALLAAAGLGTRWWVMRQYYVGAAQDGQVSVF
FT                   RGVTGNVLGFELNTVVEGSCPPGSQGCEPISLDDLKVFMRDEVSSGITAVDGLEGAREA
FT                   IRRLRTEQLLPLCADPLTSTPAPPTTTTGSATSAEQPPPSGDQGTSSSAPPTTTTEGTP
FT                   LPTLAQTPGTDCRKGQ"
     atgaccctcg tcctccgata cgcggcccgg agcgaccggg gcctggtccg ccagaacaac        60
     caggactccg tgtacgcggg cccccgcctg ctcgcgctcg ccgacggcat gggcggccac       120
     gccgcgggcg aggtcgccag caaggtcgtc atcgcggccc tggcgccgct cgacgacgac       180
     gagcccggcg acgacctgct gggtcagctg cgcgacgcgg tgatctccgg caacggggcg       240
     atctccgagc tcgtgcagag cgaccccgac ctggacggca tgggcaccac gctcaccgcc       300
     gtcctgttcg cgggcacccg actcggcatg gtgcacatcg gcgactcgcg cgcctacatg       360
     atgcgcaacg ggaccttcag ccagatcacg cacgacgaca cgttcgtcca gtcgctgatc       420
     gacgagggcc ggatcaccga ggaggaggcg gccacgcacc cgcagcgctc gctgctgctg       480
     cgcgcgctga ccggccacga ggtcgaaccg cgcctgatgg tgcgcgaggc caggccgggc       540
     gaccgctacc tgctctgctc ggacggcctc tccggcgtgg tcacgctgga gaccctggac       600
     gaggcgatcc gcatcccgga cccgcaggcg tgcgccgacc ggatgatcga gctggcgctc       660
     aagggcggcg gtccggacaa cgtgaccgtg gtcgtggccg acgtcgtcga cgtcgacttc       720
     ggcgagaacg ccccgatagt gggcggtgcg gccggtgacg gcggggacga cccgccaccg       780
     ccggactcgc ccgcctcgcg ggcgagctcc atcaccgggc cccggcccgc gccgccgagg       840
     caggagcagc cgccaccgcc gcagcaggac ccgaagcgcg agcgcaaggg gaagctgaag       900
     gcgctggcgc tggtcgtgct ggtgctcgcg ctgctggccg ccgccggtct gggcacccgc       960
     tggtgggtga tgcgccagta ctacgtgggc gcggcgcagg acggccaggt gtcggtgttc      1020
     cgcggcgtga ccgggaacgt gctcggcttc gagctgaaca cggtcgtgga gggctcgtgc      1080
     ccgcccggct cccagggctg cgagccgatc tccctggacg acctgaaggt cttcatgcgg      1140
     gacgaggtga gcagcggcat caccgccgtg gacggcctgg agggcgcccg cgaggcgatc      1200
     cgcaggctgc gcacggagca gctgctgccg ctgtgcgccg acccgctgac cagcaccccg      1260
     gccccgccca cgacgaccac gggctcggcg acgagcgccg agcagccgcc gccgagcggt      1320
     gaccagggca cgtcctcgtc ggccccgccg accaccacca cggagggcac tcccctcccc      1380
     acgctcgcgc agacgccggg cacggactgc cggaagggtc agtag                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page