(data stored in ACNUC7421 zone)

EMBL: CP001630.PE250

CP001630.PE250       Location/Qualifiers
FT   CDS_pept        278144..278917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0255"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: pca:Pcar_0009 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; SMART: HhH-GPD family protein;
FT                   iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34224"
FT                   /db_xref="GOA:C6WF92"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF92"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ACU34224.1"
FT                   /translation="MVGGARGGARPETRLGLVRRARRTVRVLGVGYPDAHCELDFTTPL
FT                   ELLVAVVLSAQCTDKRVNQVTPALFARYRSAEEYAAADRTELEELVRPTGFYRNKAAAI
FT                   SGLAAEIVERHDGEVPGTQAELVKLPGVGRKTANVVLGDAFGVPGITVDTHFGRLVRRW
FT                   GWTTEEDPVKVEHAVGALVERKDWTLLSHRTIFHGRRVCHARTPACGACLLAPQCPSFG
FT                   TGPTDPVRAAKLVKGDEAEHLIGLAERVRAGERLG"
     atggtgggtg gcgcgcgggg cggagcacgg ccggaaaccc ggttgggact cgtccgcagg        60
     gcccgccgga cggtgcgggt gctcggcgtc ggctacccgg acgcgcactg cgagctggac       120
     ttcaccaccc cgctggaact cctcgtcgcg gtcgtcctgt ccgcccagtg caccgacaag       180
     cgcgtgaacc aggtcacccc ggcgctgttc gcgcgctacc gctcggccga ggagtacgcc       240
     gccgccgacc ggaccgagct ggaggagctg gtccgcccga ccggcttcta ccgcaacaag       300
     gccgccgcga tctccgggct ggccgccgag atcgtggagc ggcacgacgg cgaggtgccg       360
     ggcacccagg ccgagctggt gaagctgccc ggcgtcggcc gcaagaccgc gaacgtggtg       420
     ctcggcgacg cgttcggcgt gccggggatc accgtcgaca cgcacttcgg gcggctggtc       480
     cgccgctggg gctggaccac cgaggaggac ccggtcaagg tcgagcacgc cgtcggcgcg       540
     ctggtcgagc gcaaggactg gaccctgctc tcccaccgga cgatcttcca cgggcgccgg       600
     gtgtgccacg ccaggacgcc cgcgtgcggc gcctgcctgc tcgcgcccca gtgcccgtcc       660
     ttcgggacgg gccccaccga tccggtccgc gctgccaagc tggtgaaggg cgacgaggcg       720
     gagcacctga tcgggttggc cgagcgggtg cgggcggggg agcggctcgg gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page