(data stored in ACNUC7421 zone)

EMBL: CP001630.PE251

CP001630.PE251       Location/Qualifiers
FT   CDS_pept        278914..279594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0256"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   xop:PXO_04554 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34225"
FT                   /db_xref="GOA:C6WF93"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF93"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACU34225.1"
FT                   /translation="MSAAARWSVVVLVLAVAGVVALWPRGEDPASPVIPQPQRDTSQRA
FT                   DLGVARNKAALRPCDQFSGNSASPASANAASPSPASPSAGPTSTSAGPEALRGATAVCL
FT                   GDGERVDAATALSGRVLVNFWASWCAPCREELRVLDDYSQRPGAIPVLGVQVKSGEADG
FT                   LDLLSRIGVHLPSLVDDSEALLRAFKVPPTLPASFLVGADGSITPVTDPLVFTSVDQVR
FT                   EVVG"
     gtgagcgcgg cggcgcggtg gtcggtggtc gtcctggtgc tcgcggtggc gggcgtggtc        60
     gccctgtggc cgaggggcga ggacccggcg agcccggtga tcccccagcc ccagcgcgac       120
     acgtcccagc gcgcggacct gggcgtggcg cgcaacaagg ccgcgctgcg gccctgcgac       180
     cagttctcgg ggaactcggc gagccccgct tccgcgaatg ccgcgtcccc gagccccgcg       240
     tccccgagcg cgggccccac gagcacgagc gcgggtcccg aggcgctgcg cggcgccacc       300
     gccgtgtgcc tgggcgacgg tgagcgggtc gacgccgcga ccgcgctgtc cggccgggtg       360
     ctggtcaact tctgggcgtc ctggtgcgcg ccctgccgcg aggagctgcg cgtgctggac       420
     gactactccc agcgccccgg cgcgatcccg gtgctcggcg tccaggtcaa gagcggcgag       480
     gcggacggcc tcgacctgct ctcccggatc ggcgtgcacc tgccgtcgct ggtcgacgac       540
     tccgaggcgc tgctgagggc cttcaaggtc ccgcccacgc tgcccgccag cttcctggtc       600
     ggcgcggacg gctccatcac cccggtgacc gacccgctcg tgttcaccag cgtcgatcag       660
     gtccgcgagg tggtcggatg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page