(data stored in ACNUC7421 zone)

EMBL: CP001630.PE252

CP001630.PE252       Location/Qualifiers
FT   CDS_pept        279591..280331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0257"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mch:Mchl_1739 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34226"
FT                   /db_xref="GOA:C6WF94"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF94"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU34226.1"
FT                   /translation="MTDRTTDPVTGHDADRAAGLAPGGAPERLVDDLGELPEWMRGLAA
FT                   AAVDADADTFLNYPKPPAFTGRAASVLMLFGEGHRGPDLLLLRRADTLGSHPGQVAFPG
FT                   GAADPEDSGPVGTALREAFEETGVLAEGVRPVALLPELHVPVSGFLVTPVLAHWRTPVP
FT                   VAPVDPGETAAVARIPVAHLADPANRFRVSHPSGYTGPAFSAPGMLVWGFTAGLVSGLL
FT                   RLGGWERPWDATDVRDLDSALRAT"
     atgaccgacc ggacgaccga tcccgtcacc ggccacgacg ccgaccgcgc cgcgggcctc        60
     gcccccggcg gggcccccga gcggctggtc gacgacctcg gcgagctgcc cgagtggatg       120
     cgcggcctgg ccgccgccgc ggtggacgcc gacgccgaca ccttcctcaa ctacccgaaa       180
     ccgcccgcct tcaccggccg cgcggcctcc gtgctcatgc tgttcggcga gggccaccgg       240
     ggccccgacc tgctcctgct gcgccgcgcc gacaccctcg gctcccaccc cggccaggtc       300
     gccttccccg gcggcgccgc cgaccccgag gactcgggcc ccgtcggcac cgcgctgcgc       360
     gaggcgttcg aggagaccgg tgtgctcgcc gagggcgtgc gaccggtggc cctgctgccc       420
     gagctgcacg tcccggtgtc cgggttcctg gtcacgcccg tgctcgcgca ctggcgcacc       480
     ccggtcccgg tcgcgccggt cgaccccggc gagacggcgg ccgtcgcccg catcccggtc       540
     gcccacctcg ccgacccggc gaaccggttc cgcgtctcgc acccgtccgg ctacaccgga       600
     cccgcgttct ccgcaccggg gatgctggtg tggggcttca ccgccggact ggtcagcggg       660
     ctgctccggc tcggcggctg ggagcgcccg tgggacgcca ccgacgtgcg agacctcgac       720
     tcggcgctgc gcgccaccta g                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page