(data stored in ACNUC7421 zone)

EMBL: CP001630.PE253

CP001630.PE253       Location/Qualifiers
FT   CDS_pept        280353..281540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0258"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; peptidase S1 and
FT                   S6 chymotrypsin/Hap; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34227"
FT                   /db_xref="GOA:C6WF95"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF95"
FT                   /inference="protein motif:PFAM:PF02674"
FT                   /protein_id="ACU34227.1"
FT                   /translation="MNWVDLLVLAIAAFAAVSGARQGMVVAVPAFIGVLVGLLLGTQLA
FT                   PVVVSRFDNVVTKVVFAVGVVVLLVALGETLGVYIGRAVKSKVNATPLRGVDNALGAVV
FT                   QGAVVFVVAWMIALPLTSVAGLPTLAKGLNQSAILSTVDGAMPQAARDLSEDLQNLFDV
FT                   SGFPAAMDPFNRTPLREVSPPDPELSGDPVVQRLRPSVLKVRGRAPSCSRALEGTGFVI
FT                   APERVMTNAHVVAGTTEVSIEVGQGKFDATVVHYDAQTDLAILAVPNLDAQPLQFRTDE
FT                   IDQGEDGIVLGYPLDGPYTASEARVRERIPMLRGPDIYDAQTVTRDVYTIRAKVRSGNS
FT                   GGPLVDREGRVMGVVFGAAVDDQETGFVLTPQEVADEVAKAPGLVRRAPTQTCAS"
     gtgaactggg tagacctgct ggtgctggcg atagccgcgt tcgccgcggt gtcgggcgcc        60
     aggcagggca tggtcgtggc cgtgcccgct ttcatcggcg tgctcgtcgg cctgctgctg       120
     ggcacgcagc tcgcgcccgt ggtggtgtcg cgcttcgaca acgtggtgac caaggtcgtc       180
     ttcgcggtcg gcgtggtggt gctcctggtc gcgctcggcg agacgctggg cgtctacatc       240
     ggacgcgcgg tcaagtccaa ggtcaacgcg accccgctgc gcggcgtgga caacgccctc       300
     ggcgcggtcg tgcagggcgc ggtggtgttc gtggtggcgt ggatgatcgc gctgccgctc       360
     acctcggtgg ccggcctgcc gacgctggcc aagggcctca accagtccgc gatcctgtcc       420
     accgtggacg gagcgatgcc gcaggcggcc cgcgacctgt ccgaggacct gcagaacctg       480
     ttcgacgtgt ccggcttccc ggccgcgatg gacccgttca accgcacccc gctcagggag       540
     gtctccccgc ccgaccccga gctcagcggc gaccccgtgg tgcagcggct gcggccgagc       600
     gtgctgaagg tgcgcggccg ggcgccctcg tgctcgcggg cgctggaggg caccgggttc       660
     gtgatcgcgc cggagcgggt catgaccaac gcgcacgtcg tcgcgggcac caccgaggtc       720
     agcatcgagg tcggccaggg caagttcgac gcgacggtcg tgcactacga cgcgcagacc       780
     gacctggcga tcctggccgt gccgaacctg gacgcgcagc cactccagtt ccgcaccgac       840
     gagatcgacc agggcgagga cggcatcgtg ctcggctacc cgctggacgg cccgtacacg       900
     gcgtccgagg cgcgggtgcg cgagcgcatc cccatgctgc gcgggccgga catctacgac       960
     gcgcagaccg tgacgcggga cgtctacacg atccgggcga aggtccgcag cggcaactcc      1020
     ggcggcccgc tggtcgaccg ggagggccgg gtcatgggcg tggtgttcgg cgcggccgtg      1080
     gacgaccagg agaccgggtt cgtgctgacc ccgcaggagg tcgccgacga ggtggccaag      1140
     gcgccggggc tggtgcggcg cgcgcccacg cagacctgcg cgtcctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page