(data stored in ACNUC7421 zone)

EMBL: CP001630.PE254

CP001630.PE254       Location/Qualifiers
FT   CDS_pept        complement(281588..282514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0259"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   acp:A2cp1_0551 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34228"
FT                   /db_xref="GOA:C6WF96"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF96"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU34228.1"
FT                   /translation="MAPPPDPSSARIPGPWAHRDVSANGIRLHVAELGDGPLVLLLHGF
FT                   PEFWWSWRHQLVDLAEAGYRAVAVDLRGYGDSDKPPRGYDGFTLAGDVAGLVKALGEPR
FT                   AHVVGHAWGGMLAWVVGALHPRLVRSVTAVSAPHPLALRRAVRRNTAGQARALGHLLRF
FT                   QLPVLPERSLLAANGARVGELLRAWGGAGWTASPEFAEVVERNTAAVRIPGVAHSALEY
FT                   HRWAVRSQVRSDGRRFVEAVSRKLEAPVLQVQGARDPVMLAQTALDSARWRGPDSVLRV
FT                   LQDVGHFPHQEDRAEVSRVIAGFLAER"
     gtggcgccgc caccggaccc gtcgtccgcg cggatacccg gcccgtgggc gcaccgcgac        60
     gtgtccgcca acggcatccg gctgcacgtg gccgagctgg gcgacggacc gctcgtgctg       120
     ctgctgcacg ggttccccga gttctggtgg tcctggcggc accagctggt cgacctggcc       180
     gaggccgggt accgggcggt ggccgtcgac ctgcgcgggt acggggactc ggacaagccg       240
     ccgaggggct acgacgggtt cacgctcgcc ggtgacgtcg ccgggctggt caaggcgctc       300
     ggcgagccca gggcgcacgt cgtcgggcac gcctggggcg ggatgctggc ctgggtggtc       360
     ggcgcgctgc acccccgcct cgtgcggtcg gtgacggccg tgtccgcgcc gcacccgctg       420
     gcgctgcgcc gggccgtgcg gcgcaacacc gccgggcagg cgcgcgcgct ggggcacctg       480
     ctgcggttcc agctgccggt gctgccggag cgctccctgc tggccgcgaa cggcgcccgc       540
     gtcggcgagc tgctgcgcgc ctggggtggc gcggggtgga cggcctcgcc ggagttcgcc       600
     gaggtggtcg agcggaacac cgccgccgtg cgcatccccg gcgtggcgca cagcgcgctg       660
     gagtaccacc ggtgggcggt gcgctcgcag gtgcgcagcg acgggcggcg gttcgtggag       720
     gcggtgtccc ggaagctgga ggccccggtg ctccaggtgc agggcgcccg cgacccggtg       780
     atgctcgcgc agaccgcgct cgactcggcc cgctggcgcg gtccggactc ggtgctgcgg       840
     gtgctccagg acgtcgggca cttcccgcac caggaggacc gcgccgaggt cagccgcgtg       900
     atcgcgggct tcctggccga gcggtag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page