(data stored in ACNUC7421 zone)

EMBL: CP001630.PE255

CP001630.PE255       Location/Qualifiers
FT   CDS_pept        complement(282523..282990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0260"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   mpo:Mpop_1689 protein of unknown function DUF1469"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34229"
FT                   /db_xref="GOA:C6WF97"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF97"
FT                   /inference="protein motif:PFAM:PF07332"
FT                   /protein_id="ACU34229.1"
FT                   /translation="MTTPSENTPPPIPSIPLTAENASTIAGETSIGGLVRDATAHVSTL
FT                   LRAEVELAKAEVTHEVKRGLKGSVFFILALVVLSFSLFFFFMFVAELIAVWLPVWAGYL
FT                   IVFGLMIGITVLLGLLGYRKMKTLRAPTRTIESAKETVAVLRRRDDQDDTP"
     gtgaccaccc cgagtgagaa cacgccgcct ccaatcccgt cgatcccgct gacggcggag        60
     aacgcctcga cgatcgccgg ggagacctcg atcggcgggc tggtgcgcga cgcgacagcc       120
     cacgtgtcga ccctgctgcg ggccgaggtg gagctggcca aggccgaggt gacccacgag       180
     gtcaagcggg ggctgaaggg cagcgtcttc ttcatcctgg cgctggtggt cctctccttc       240
     agcctgttct tcttcttcat gttcgtggcc gagctgatcg cggtgtggct gcccgtctgg       300
     gccggctacc tgatcgtctt cggcctgatg atcggcatca cggtcctgct cgggctcctg       360
     ggctaccgga agatgaagac gctgcgcgcc ccgacgcgga cgatcgagtc cgcgaaggag       420
     accgtcgcgg tgctgcggcg ccgcgacgac caggacgaca ccccctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page