(data stored in ACNUC7421 zone)

EMBL: CP001630.PE256

CP001630.PE256       Location/Qualifiers
FT   CDS_pept        complement(283062..284234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0261"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; sodium/hydrogen exchanger; KEGG:
FT                   mlo:mlr5309 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34230"
FT                   /db_xref="GOA:C6WF98"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF98"
FT                   /inference="protein motif:TFAM:TIGR00773"
FT                   /protein_id="ACU34230.1"
FT                   /translation="MSSPARKPAADFARYLRTETTGGIVLLVATAIALLWANSPLGDSY
FT                   TALRETHLGPLTIGDWVKDGLLAVFFFVAGLELKRELVVGELNSLKAAALPVIAAVGGM
FT                   VVPALVALGFSWGEPGAGQAWAIPMATDIAFALGVLAIAGSALPSSVRVFLLSLAVVDD
FT                   LGAIAVIAVLFTSGLELLAVLAAVALLALYAFLQHKRVTATWLYVPIAVGAWVAVHEAG
FT                   VHATIAGVALGLLTRVRADEGEDEAPAARLEHRLQPWSAGLVVPLFALFAAGVPIGGDA
FT                   LRALVDDPIALGVVAGLVLGKVIGILGFSALAVRLRLAVWPSGAGPRDVAAVGVLGGVG
FT                   FTVSLLIADLALAGEAAERAKAAVLIASLLASLIAAVLLVRRGRAHRDSD"
     ttgtcctccc ccgcccgcaa gcccgccgcc gacttcgccc gctacctgcg caccgagacc        60
     accggcggca tcgtcctgct cgtggccacc gcgatcgcgc tgctgtgggc caactccccg       120
     ctcggcgact cctacaccgc gctccgcgag acgcacctcg gcccgctcac catcggtgac       180
     tgggtcaagg acggcctgct cgcggtgttc ttcttcgtcg ccgggctgga gctcaagcgc       240
     gagctggtgg tcggcgagct gaacagcctc aaggccgccg ccctgcccgt gatcgccgcg       300
     gtcggcggca tggtggtccc cgcgctggtc gcgctcggct tctcctgggg cgaaccgggc       360
     gcgggccagg cgtgggcgat cccgatggcc accgacatcg cgttcgcgct gggcgtgctg       420
     gcgatcgccg ggtcggcgct gccgagcagc gtccgggtgt tcctgctcag cctcgcggtg       480
     gtggacgacc tgggcgcgat cgcggtgatc gcggtgctgt tcacctccgg gctggagctg       540
     ctcgcggtgc tggccgccgt cgcgctgctc gccctgtacg ccttcctcca gcacaagcgg       600
     gtcaccgcga cctggctcta cgtcccgatc gcggtgggcg cctgggtcgc ggtccacgag       660
     gccggggtcc acgccacgat cgccggggtg gcgctcgggc tgctgacccg cgtgcgcgcc       720
     gacgagggcg aggacgaggc gcccgccgcg cgcctggagc accggttgca gccgtggtcg       780
     gccgggctgg tggtgccgct gttcgcgctc ttcgcggcgg gcgtcccgat cggcggggac       840
     gccctgcgcg cgctggtgga cgacccgatc gcgctgggcg tcgtcgcggg tctggtgctg       900
     ggcaaggtga tcggcatcct cggcttctcc gcgctggcgg tgcggctgag gctcgcggtg       960
     tggccgagcg gggcgggacc gcgcgacgtc gcggcggtgg gcgtgctcgg cggcgtcggg      1020
     ttcacggtga gcctgctgat cgccgacctc gcgctggccg gcgaggcggc cgaacgggcc      1080
     aaggccgcgg tgctgatcgc gtccctgctg gcgtcgctga tcgcggccgt cctgctggtg      1140
     cggcggggca gagcgcaccg ggactcggac tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page