(data stored in ACNUC7421 zone)

EMBL: CP001630.PE257

CP001630.PE257       Location/Qualifiers
FT   CDS_pept        complement(284370..286355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0262"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: aba:Acid345_3520
FT                   acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34231"
FT                   /db_xref="GOA:C6WF99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF99"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ACU34231.1"
FT                   /translation="MTKPNENGPTLDNLLTESRTFPPSEEFAAQANATQALYDSAAADR
FT                   EAFWAEQADRLTWERKWDRVLDWSDAPFAKWFVGGRLNVAYNCVDRHVESGHGEQVAIH
FT                   WEGEPGDSRTITYADLKRDVSKAANALASLGVGAEDRVAIYMPMVPEAIVAMLACARIG
FT                   ALHSVVFGGFSAEALRTRVEDSQAKLVITTDGQYRRGNPAPLKPAVDEAVSKAASVEHV
FT                   LVVRRTGGEVAWTEGRDLWWHELVDGQSEEHAPEAFDSEHPLFILYTSGTTGNPKGILH
FT                   TSGGYLTQTAYTHHNVFDLKPDSDVYWCTADIGWVTGHSYIVYGPLANRVTQVVYEGTP
FT                   NTPHEGRHWEIVQKYGVSIYYTAPTLIRTFMKWGAEIPAKHDLSSLRVLGSVGEPINPE
FT                   AWIWYRENIGAGKAPIVDTWWQTETGAIMISPLPGVVSTKPGSAQRPLPGVGAKVVDDQ
FT                   GVEVGPGGGGYLVLDEPWPSMLRGIWGDDARYRDTYWSRFAEEGFYFAGDGAKYDADGD
FT                   IWLLGRVDDVMNVSGHRISTTEVESALVSHPTVAEAAVVGATDPTTGQGIVAFVILRGG
FT                   VAAGSDGAEAIKALRDHVAKEIGPIAKPRQIMVVPELPKTRSGKIMRRLLRDVAENRQV
FT                   GDVTTLADSSVMDLISSGLKKGSGED"
     atgaccaagc cgaacgagaa cggcccgacc ctggacaacc tgctgaccga gagccgcacg        60
     ttccccccgt ccgaggagtt cgccgcgcag gcgaacgcca cccaggcgct gtacgactcg       120
     gccgccgccg accgcgaggc cttctgggcc gagcaggccg accggctgac ctgggagcgg       180
     aagtgggacc gggtcctcga ctggtccgac gcaccgttcg ccaagtggtt cgtcggcggc       240
     aggctcaacg tcgcctacaa ctgcgtcgac cggcacgtcg agtccggcca cggcgagcag       300
     gtcgccatcc actgggaggg cgagcccggc gacagccgga ccatcaccta cgccgacctc       360
     aagcgcgacg tctccaaggc cgccaacgcg ctggcctcgc tcggcgtcgg cgccgaggac       420
     cgggtcgcca tctacatgcc gatggtcccc gaggcgatcg tcgccatgct ggcctgcgcc       480
     cgcatcggcg cgctgcacag cgtcgtgttc ggcggcttct cggccgaggc gctgcgcacc       540
     cgcgtcgagg actcgcaggc caagctggtg atcaccaccg acggccagta ccggcgcggc       600
     aacccggccc cgctcaagcc cgccgtggac gaggccgtgt cgaaggccgc gagcgtcgag       660
     cacgtgctgg tggtgcggcg caccggcggc gaggtggcct ggaccgaggg ccgcgacctg       720
     tggtggcacg agctggtgga cggccagtcc gaggagcacg cccccgaggc gttcgactcc       780
     gagcacccgc tgttcatcct ctacacctcg ggcaccaccg ggaaccccaa gggcatcctg       840
     cacacctccg gcggctacct cacgcagacc gcctacacgc accacaacgt gttcgacctc       900
     aagccggaca gcgacgtcta ctggtgcacc gccgacatcg gctgggtcac cgggcacagc       960
     tacatcgtgt acggcccgct ggccaaccgg gtcacccagg tcgtctacga gggcaccccg      1020
     aacaccccgc acgagggccg ccactgggag atcgtgcaga agtacggcgt ctcgatctac      1080
     tacaccgcgc cgacgctgat ccgcacgttc atgaagtggg gcgcggagat cccggccaag      1140
     cacgacctgt cgtcgctgcg ggtgctcggc agcgtcggcg agccgatcaa ccccgaggcg      1200
     tggatctggt accgggagaa catcggcgcg ggcaaggcgc cgatcgtgga cacctggtgg      1260
     cagaccgaga ccggcgcgat catgatctcg ccgctgcccg gcgtggtgtc caccaagccc      1320
     ggttcggcgc agcgcccgct gcccggcgtc ggtgcgaagg tcgtggacga ccagggcgtc      1380
     gaggtcggcc ccggcggtgg cggctacctg gtgctggacg agccgtggcc gtcgatgctg      1440
     cgcggcatct ggggcgacga cgcgcgctac cgcgacacct actggtcgcg gttcgccgag      1500
     gagggcttct acttcgcggg cgacggcgcg aagtacgacg cggacggcga catctggctg      1560
     ctgggccggg tggacgacgt gatgaacgtg tccgggcacc ggatctccac caccgaggtg      1620
     gagtccgcgc tggtgtcgca cccgaccgtg gcggaggcgg cggtggtcgg ggcgaccgat      1680
     ccgacgaccg ggcagggcat cgtggcgttc gtgatcctgc gcggcggggt cgccgcgggc      1740
     tcggacgggg ccgaggcgat caaggcgctg cgcgaccacg tggccaagga gatcgggccg      1800
     atcgcgaagc ccaggcagat catggtcgtg ccggagctgc cgaagacccg ctcgggcaag      1860
     atcatgcgcc gcctgctgcg cgacgtggcg gagaaccgcc aggtcggcga cgtgacgacg      1920
     ctggccgact cgtccgtgat ggacctgatc tcctccggcc tgaagaaggg ctccggggag      1980
     gactga                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page