(data stored in ACNUC7421 zone)

EMBL: CP001630.PE258

CP001630.PE258       Location/Qualifiers
FT   CDS_pept        complement(286579..287160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0263"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   aav:Aave_3953 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34232"
FT                   /db_xref="GOA:C6WFA0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34232.1"
FT                   /translation="MTWFDRPVLSDPHVRLEPLTPDHAPGLLKAGADPGVWTWLSSRQP
FT                   TDLPAMAAFVDRALTDPDRAPWAQVDPATGEVVGTTSYYEVDPEHRNLCIGHTWIGAPW
FT                   QRTPLNTAAKLLLLTRAFDGLGALRVGWHTDIRNERSQRAIARLGATREGVLRAHRIRP
FT                   DGTVRDTVVFSVTAPEWPGVRDRLVARLAE"
     atgacctggt tcgaccgccc cgtgctcagc gatccccacg tccggctgga gccgctgacc        60
     ccggaccacg cccccggact gctcaaggcg ggcgcggacc ccggcgtgtg gacctggctg       120
     agcagccgcc agccgaccga cctgcccgcg atggccgcgt tcgtggaccg ggcgctgacc       180
     gacccggacc gggcgccgtg ggcgcaggtc gacccggcca ccggcgaggt cgtgggcacc       240
     acctcgtact acgaggtcga ccccgagcac cggaacctgt gcatcggcca cacctggatc       300
     ggcgcgccct ggcagcgcac cccgctgaac acggccgcga agctgctcct gctcacccgc       360
     gcgttcgacg ggctgggcgc gctgcgcgtg ggctggcaca ccgacatccg caacgagcgc       420
     tcgcagcggg ccatcgcccg gctcggcgcg acccgcgagg gggtgctgcg cgcgcaccgg       480
     atcaggccgg acggcaccgt ccgggacacc gtggtgttct cggtgacggc gccggagtgg       540
     cccggcgtgc gtgaccggct cgtggcacga ctggccgagt ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page