(data stored in ACNUC7421 zone)

EMBL: CP001630.PE259

CP001630.PE259       Location/Qualifiers
FT   CDS_pept        287252..287974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34233"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34233.1"
FT                   /translation="MTDPLAPLLDLPGVADAVASARDAVFRVHRHRVNLRGWATTAAEA
FT                   SVRAARASAALDGGPTTIPEDGEVTDPVLAGALRVAESLGVVFPTWQRAPLQALAKLHV
FT                   LAAADLGTELGRPRLVPGVAERLDLLAGLVTGGTSAPGPLVVAVVHGELMALTPFDTAN
FT                   GVVARAASRLASIATGLDPKSLGVPEVWCLRRRSEYDAALHGFSTGEPEGVARWITFSC
FT                   AALEAGAREAQGIADAAA"
     gtgaccgatc cgctcgcacc gctgctggac ctgcccggcg tcgccgacgc ggtcgcctcc        60
     gcccgcgacg ccgtgttccg ggtgcaccgg caccgcgtca acctgcgcgg ctgggccacc       120
     acggcggccg aggcctcggt gcgcgcggcc agggcgtccg ccgcgctcga cggcggcccc       180
     accacgatcc ccgaggacgg cgaggtcacc gaccccgtgc tcgcgggcgc gctgcgcgtc       240
     gccgagtcgc tgggcgtggt gttcccgacc tggcagcgcg ccccgctcca ggcgctggcc       300
     aagctgcacg tcctcgccgc cgccgacctg gggaccgagc tgggcaggcc ccggctggtg       360
     cccggcgtcg ccgagcggct cgacctgctc gcgggcctgg tcaccggcgg cacgtccgcc       420
     cccggcccgc tcgtggtggc cgtggtgcac ggcgagctga tggccctgac cccgttcgac       480
     accgccaacg gcgtggtcgc ccgcgcggcg tcccggctgg cctccatcgc gaccgggctc       540
     gacccgaaga gcctgggcgt gcccgaggtg tggtgcctgc gcaggcgctc cgagtacgac       600
     gcggcactgc acgggttctc caccggcgag cccgagggcg tggcgcggtg gatcacgttc       660
     agctgcgcgg cgctggaagc gggcgcccgc gaggcccagg gcatcgcgga cgccgccgcc       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page