(data stored in ACNUC7421 zone)

EMBL: CP001630.PE26

CP001630.PE26        Location/Qualifiers
FT   CDS_pept        complement(29376..29840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0026"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mxa:MXAN_4649 FHA domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34000"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU34000.1"
FT                   /translation="MPELVMQLTRAGFLILLWLFVLAALRVVRSDLYAASGLRVPTPSI
FT                   KKGFRGAGKGGAKAPRQLVVTQGALSGTRITLDGKPIMIGRADDSTLVLDDDFASTRHA
FT                   RLSARGDEWFVEDLGSTNGTYLDRAKVTSPVRVPIGSQIRIGKTVIELRS"
     gtgccagagc tggtgatgca gctgaccaga gcggggttcc tcatcctgct ctggttgttc        60
     gtgttggctg cgcttcgagt ggtgcgttcc gacctctacg cggcgtcggg gctgagggtc       120
     ccgacgccgt cgatcaagaa ggggttcagg ggggcaggca agggcggggc gaaggcgccc       180
     cggcagctcg tggtcacgca gggggccctg tcgggcaccc ggatcacgct tgacgggaag       240
     ccgatcatga tcggccgggc cgacgactcc acgctcgtgc tggacgacga cttcgcgtcg       300
     acccggcacg cgcggctgtc ggcgcgcggt gacgagtggt tcgtggagga cctggggtcc       360
     accaacggca cctacctcga ccgcgcgaag gtcaccagcc cggtccgggt cccgatcggg       420
     tcccagatcc ggatcggcaa gacggtgatc gagctgaggt catga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page