(data stored in ACNUC7421 zone)

EMBL: CP001630.PE260

CP001630.PE260       Location/Qualifiers
FT   CDS_pept        complement(287971..289092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0265"
FT                   /product="kynureninase"
FT                   /note="TIGRFAM: kynureninase; PFAM: aminotransferase class
FT                   V; KEGG: pde:Pden_2620 kynureninase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34234"
FT                   /db_xref="GOA:C6WFA2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA2"
FT                   /inference="protein motif:TFAM:TIGR01814"
FT                   /protein_id="ACU34234.1"
FT                   /translation="MTDPLAHVRELFDLADDVVYLDGNSLGAPPRAVAERLDDVVRRQW
FT                   GRRLIRSWSEGWWEAPQRVGDRIGRLVGAAPGQVVVGDSTSVNLFKALVGAVRGTDRSE
FT                   IVVDAGTFPTDGYIAGSAAELTGLSLRPADPDDLRLDERTAVVLLNHVDYRTGRLLDMA
FT                   GLTERAHEVGAKVVWDLCHSVGVLPIELDALGVDLAVGCTYKFLNGGPGSPAFLYVPSA
FT                   AQPGFRQPLTGWTGHREPFAMAAEYTPDAGIGRARAGTPDILSMLALDAALDVWDGVEL
FT                   ADVRAKGLALTARFMELVRDLPGIEVITPADGRRGHQVSLRHPEAARLMAELIAGGVIG
FT                   DHRPPDVLRFGFAPLYNTFDEAERAAKALEELL"
     gtgaccgacc cgctcgccca cgtcagggag ctgttcgacc tggccgacga cgtggtgtac        60
     ctggacggca actcgctggg cgcgccgccg agggcggtgg ccgagcggct ggacgacgtg       120
     gtccgcaggc agtgggggcg caggctgatc cgctcctggt cggagggctg gtgggaggcc       180
     ccgcagcggg tcggcgaccg gatcgggcgg ctcgtggggg ccgcgccggg gcaggtcgtg       240
     gtgggcgact cgaccagcgt gaacctgttc aaggcgctgg tgggggcggt gcgcggcacc       300
     gaccggtccg agatcgtggt ggacgcgggc acgttcccga ccgacggcta catcgccggg       360
     tcggcggccg agctgaccgg gctgtcgctg cgcccggccg acccggacga cctgcggctg       420
     gacgagcgca cggcggtggt gctgctcaac cacgtcgact accggaccgg gcggctgctg       480
     gacatggccg ggctgaccga gcgggcgcac gaggtgggcg cgaaggtcgt ctgggacctg       540
     tgccacagcg tcggcgtgct gccgatcgag ctggacgcgc tgggcgtgga cctggcggtg       600
     ggctgcacct acaagttcct caacggcggc cccggctcgc ccgcgttcct gtacgtgccg       660
     agcgcggcgc agccggggtt ccggcagccg ctgaccggct ggaccgggca ccgggagccg       720
     ttcgcgatgg ccgccgagta caccccggac gccgggatcg ggcgggcgcg ggcgggcacg       780
     ccggacatcc tgtcgatgct ggccctggac gccgcgctgg acgtgtggga cggggtggag       840
     ctggcggacg tgcgggccaa ggggctggcg ctgacggcgc ggttcatgga gctggtgcgg       900
     gacctgccgg gcatcgaggt gatcacgccc gccgacgggc ggcgcggcca ccaggtgtcg       960
     ctgcggcacc cggaggcggc gcggctgatg gccgagctga tcgcgggcgg ggtgatcggc      1020
     gaccaccggc cgccggacgt gctgcggttc ggcttcgcgc cgctgtacaa cacgttcgac      1080
     gaggcggagc gcgccgcgaa ggccctggaa gagctgctct ag                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page