(data stored in ACNUC7421 zone)

EMBL: CP001630.PE261

CP001630.PE261       Location/Qualifiers
FT   CDS_pept        complement(289089..289910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0266"
FT                   /product="tryptophan 23-dioxygenase"
FT                   /note="PFAM: tryptophan 23-dioxygenase; KEGG: reh:H16_B1418
FT                   tryptophan 2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34235"
FT                   /db_xref="GOA:C6WFA3"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA3"
FT                   /inference="protein motif:PFAM:PF03301"
FT                   /protein_id="ACU34235.1"
FT                   /translation="MEQVCPVAPKLDFGGTTPYEDYVRASVLHTLQRQASDDPREMSFL
FT                   VTTQVMELYFGLLCFEWRQAQKELRADDVTAAVRTLRRSELHMQALNAAWRPIARMTPG
FT                   EFNSFRDALGEGSGFQSGRYREVEFLLGEKSRSMLVPHRSAPAQHDALEALLSEPSLYD
FT                   DVLAALHRRGLDVPDELLKRDFAEAYAPDERVEAVWAHVYREGPRDLLELGEALTDVAE
FT                   EFSRWRHDHLLATRRSMGSKVGTGGSAGVAWLEKRVRRAVFPELWTARSYV"
     atggaacagg tgtgcccggt cgccccgaag ctggacttcg gcgggaccac gccgtacgag        60
     gactacgtgc gcgcctccgt cctgcacacg ttgcagcggc aggcgtccga cgacccgcgc       120
     gagatgtcgt tcctggtgac gacccaggtg atggagctgt acttcggcct gctgtgcttc       180
     gagtggcggc aggcgcagaa ggagctgcgg gcggacgacg tgaccgcggc ggtgcgcacg       240
     ctgcgccgca gcgagctgca catgcaggcg ctgaacgcgg cgtggcggcc gatcgcccgg       300
     atgacgccgg gcgagttcaa ctcgttccgg gacgcgctcg gcgagggctc gggcttccag       360
     tccggccgct accgcgaggt ggagttcctg ctgggcgaga agtcccggtc gatgctggtg       420
     ccgcaccgct cggcgcccgc gcagcacgac gcgctggagg cgctgctgag cgagccgagc       480
     ctgtacgacg acgtgctcgc ggcgctgcac cggcgggggc tggacgtgcc ggacgagctg       540
     ctcaagcgcg acttcgccga ggcgtacgcg ccggacgagc gggtcgaggc ggtgtgggcg       600
     cacgtctacc gggagggtcc gagggacctg ctggagctgg gcgaggcgct gaccgacgtg       660
     gccgaggagt tctcccgctg gcggcacgac cacctgctcg cgacgcggcg ctcgatgggg       720
     tccaaggtgg ggaccggcgg gtcggcgggc gtggcgtggt tggagaagcg cgtgcgccgg       780
     gccgtgttcc cggagctgtg gaccgcgagg agctacgtgt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page