(data stored in ACNUC7421 zone)

EMBL: CP001630.PE262

CP001630.PE262       Location/Qualifiers
FT   CDS_pept        290017..290466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0267"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: bam:Bamb_3888
FT                   AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34236"
FT                   /db_xref="GOA:C6WFA4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA4"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACU34236.1"
FT                   /translation="MRTDLDAVDWALVDALQADARLSYNELARKVGVSPPTVAQRVRRL
FT                   ENAGVITGYRAVVDPTAVGRSVIALVRMKCYGPRCITVHPELLDDCPEVVEVVRLTGDI
FT                   CSVVKVVTTSVSELERLLVRLGGHGETSSAMVLSTPIPWRPLTAG"
     gtgagaacgg acctcgacgc ggtcgactgg gcgctggtcg acgccctcca ggccgatgcc        60
     cggctgtcct acaacgagct ggcccgcaag gtcggcgtgt ccccgccgac ggtggcgcaa       120
     cgggtgcgca ggctggagaa cgcgggcgtg atcaccggct accgcgcggt ggtcgacccc       180
     acggcggtcg gccgctcggt gatcgccctg gtgcggatga agtgctacgg gccccggtgc       240
     atcaccgtgc accccgagct gctcgacgac tgccccgagg tggtggaggt ggtgcggctg       300
     accggggaca tctgctcggt ggtcaaggtc gtcacgacct cggtcagcga gctggagcgg       360
     ctgctcgtgc gcctgggcgg gcacggggag acgtccagcg cgatggtgct gtcgacgcct       420
     atcccgtggc gcccgctgac agccgggtga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page