(data stored in ACNUC7421 zone)

EMBL: CP001630.PE263

CP001630.PE263       Location/Qualifiers
FT   CDS_pept        complement(290435..291361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0268"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="TIGRFAM: glucokinase regulatory-like protein; KEGG:
FT                   spe:Spro_3661 N-acetylmuramic acid-6- phosphate etherase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34237"
FT                   /db_xref="GOA:C6WFA5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA5"
FT                   /inference="protein motif:TFAM:TIGR00274"
FT                   /protein_id="ACU34237.1"
FT                   /translation="MTARGDVVRVESPTEARNPRTGEIDRMSTLDVLRMINSEDRGVPD
FT                   AVAAVLPELARAADLAVAALRGGGRVHYVGAGTSGRLATLDAAELPPTFNTPPDWFVAH
FT                   HAGGAEALVRAVENAEDQAATGAERIRAHAEPGDLVLGVTASGRTPFVLGALAAAHELG
FT                   ARTALVSNNPSAPPVPVDVLITVDTGPEAIAGSTRMKAGSSQKLVLTAFSTAVMVRMGR
FT                   TYSNLMVSVRATNAKLRGRTVRILSEATGLDERECTDALTAAGDDLKVALVHLLSGSPA
FT                   PDAAEALTATGGHVRQALTRLSAGATG"
     atgaccgcgc ggggcgacgt ggtgcgggtg gagtccccga ccgaggcgcg caacccgcgc        60
     accggggaga tcgaccggat gtccaccctg gacgtcctgc ggatgatcaa ctccgaggac       120
     cggggcgtcc cggacgcggt cgccgccgtg ctgcccgagc tggcccgcgc ggccgatctc       180
     gcggtggccg cgctgcgcgg cggcggccgg gtgcactacg tgggcgcggg cacgtccggc       240
     aggctcgcca cgctggacgc ggccgagctg ccgcccacgt tcaacacccc gccggactgg       300
     ttcgtcgccc accacgcggg tggcgcggag gcgctggtgc gggcggtgga gaacgccgag       360
     gaccaggccg ccacgggtgc cgagcgcatc cgcgcgcacg ccgaaccggg cgacctcgtg       420
     ctcggggtga ccgcgtccgg ccgcaccccg ttcgtgctcg gcgcgctggc cgccgcccac       480
     gagctgggcg cccgcaccgc gctggtgtcg aacaacccga gcgcgccgcc cgtcccggtg       540
     gacgtgctga tcaccgtgga caccggtccg gaggcgatcg ccggctcgac caggatgaag       600
     gcgggcagct cgcagaagct ggtgctgacc gcgttctcca cggccgtgat ggtgcggatg       660
     ggccgcacct actcgaacct gatggtgtcg gtgcgggcca cgaacgcgaa gctgcgcggc       720
     cggaccgtgc gcatcctgag cgaggcgacc ggcctggacg agcgggagtg caccgacgcg       780
     ctcaccgcgg cgggcgacga cctcaaggtc gcgctggtgc acctgctgtc cggctcgccc       840
     gcgccggacg cggccgaggc gctgaccgcg accggcgggc acgtgcggca ggcgctcacc       900
     cggctgtcag cgggcgccac gggatag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page