(data stored in ACNUC7421 zone)

EMBL: CP001630.PE264

CP001630.PE264       Location/Qualifiers
FT   CDS_pept        complement(291358..292272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0269"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: sugar isomerase (SIS); helix-turn-helix
FT                   protein RpiR; KEGG: reh:H16_B1066 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34238"
FT                   /db_xref="GOA:C6WFA6"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA6"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ACU34238.1"
FT                   /translation="MSTENTDASPLVKIRSLLPGLARAEQRVAKVVLDNPATVAHRSIT
FT                   EVAESAGTSETTVTRFCKAIGVGGYPELRIALAADTARTAARTDRDLGGDIGPGDDLRQ
FT                   VVGKVAFADARAVEETAEQLNVDTLQAVVDAVARAGRVDVYGFGASAFVAFDLQQKLHR
FT                   IGRTCFAWNDTHIALTSAAVLTGADVAVGISHTGSTTETVEALRVARERGATTVALTNF
FT                   PRSPISEVADHVLTTAARETTFRSGAMASRIAQLTVVDCLFIGVAQHHVESATSALEAT
FT                   YDAVAGHRLGARPDGRRRREAGR"
     gtgtccaccg agaacaccga cgccagtcca ctcgtgaaga tccgctccct gctccccggc        60
     ctcgccaggg cggagcagcg ggtggccaag gtcgtgctgg acaacccggc gaccgtggcg       120
     caccgcagca tcaccgaggt ggccgagtcc gcgggcacca gcgagaccac cgtgacgcgg       180
     ttctgcaagg cgatcggcgt cggcggctac ccggagctgc ggatcgcgct ggccgccgac       240
     accgcgcgca ccgccgcccg caccgaccgg gacctcggcg gcgacatcgg ccccggcgac       300
     gacctgcggc aggtggtcgg caaggtcgcg ttcgccgacg cccgcgccgt ggaggagacc       360
     gccgagcagc tgaacgtgga caccctgcag gccgtggtgg acgcggtggc gcgggcgggc       420
     cgggtcgacg tctacggctt cggcgccagc gcgttcgtcg ccttcgacct ccagcagaag       480
     ctgcaccgca tcggccgcac ctgcttcgcc tggaacgaca cgcacatcgc gctcacctcg       540
     gccgccgtgc tgaccggcgc ggacgtggcc gtgggcatct cgcacaccgg ctccaccacc       600
     gagacggtcg aggcgctgcg ggtggcgcgc gagcgcggcg cgaccacggt ggcgctgacg       660
     aacttcccgc gctcccccat cagcgaggtc gccgaccacg tgctgaccac ggcggcccgc       720
     gagaccacgt tccgctcggg cgcgatggcc agccgcatcg cccagctgac cgtggtcgac       780
     tgcctgttca tcggggtcgc gcagcaccac gtggagagcg cgacgagcgc gctggaggcg       840
     acctacgacg cggtcgcggg acaccggctg ggcgcccgcc cggacggcag gcggcggcgg       900
     gaggccggga gatga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page