(data stored in ACNUC7421 zone)

EMBL: CP001630.PE265

CP001630.PE265       Location/Qualifiers
FT   CDS_pept        complement(292383..294536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0270"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34239"
FT                   /db_xref="GOA:C6WFA7"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA7"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACU34239.1"
FT                   /translation="MRLPTRPATAAPHPAARLRTTDADTSTSTSTATTNTGTSTSTGTG
FT                   TSTGTGTGTGTGTAVLRLPARLGASITRLLAGLGKSVPQAFVRLGGSITRLPDRLSTTV
FT                   LRLPDRLGVVVVWLRGLLGGSAARRGGSSTAVVLRPLGWPGAGMARLRGLLGGSAARRA
FT                   GSLGTIGLRLSALLGATALLLGTLAPVSAETVPRARFDQPWAGFAPVGTVLRAGAPERV
FT                   GVDPVPVERALGVVRGYTVGAAPLFPGAVTLMAHDGVVVGHEAVGWAVRYADGVSELPV
FT                   GERVPTALDTIFDLASISKLFTSIVVVRQAELGRVGIERPVAEYLPEFGVAGKGDITVR
FT                   QLLTHTSGLAAWLPLWSGWPDRDSRIKAVMDVAPARAPGTGYLYSDLNLITLGVLVERV
FT                   SGMPLDALVRETITEPLGLVDTGYNPPPEKLGRIAATEFQTSPPRGIVRGSVHDENAWS
FT                   LGGVAGHAGVFSTARELAVLGQAILNGGAYRGKRILSEESVTGMLTNLTPEFPGNSHGL
FT                   GFELDTRWYMGALSAPRTAGHTGFTGTTMVLDPASRSIALLLTNRVHPSRDRGSINPAR
FT                   RAVASGLAEALAVGPVRGRSAWRGDPGGTLTTKPLPDGPKVLRFSAFTDLDAGESVAVQ
FT                   EFDGSGWRDLRVLTGAGTRTWERVELPMTGTAARWVRSGVGANGARGGYVDAIEVVAGR
FT                   RVLLDGERGTGEVTASGWRAVDR"
     atgcgcctgc ccacccgccc ggcaacggcc gcaccacacc cggcggcacg gctgagaacc        60
     accgatgccg ataccagcac cagcaccagc actgccacca ccaacacggg cacgagcacg       120
     agcaccggca cgggcacgag caccggcacc ggcaccggca ccggcaccgg caccgctgta       180
     ttgcgcctac ccgcccgact gggcgcaagc atcacgcgcc tgcttgccgg gctgggcaag       240
     agcgtgccac aagcgttcgt ccggctgggc ggaagcatca cgcgcctgcc tgaccggctg       300
     agcaccaccg tgctgcgcct gcctgaccgg ttgggcgtgg tcgtggtgtg gttgcgcggc       360
     ttgctgggcg ggagcgcggc gcggcgcggc gggtcgtcga ccgcagtcgt gctgcgtccg       420
     cttggttggc cgggcgcggg tatggcgcgg ttgcgcggct tgctgggcgg gagcgcggcg       480
     cggcgggccg gttcgttggg cacgatcggg ctgcggctgt ctgccctgct gggcgcgacc       540
     gcgttgctgt tgggcaccct ggcgccggtg agtgccgaga ctgttccgcg tgcccggttc       600
     gaccagccgt gggcggggtt cgcgccggtg gggacggtgt tgcgggctgg ggctcctgag       660
     cgggtcgggg tggatccggt tcctgttgag cgggcgttgg gggtggtgcg ggggtacacc       720
     gttggggctg ctccgttgtt tcccggtgcg gtcacgctga tggcgcacga cggggtggtt       780
     gttgggcacg aggccgttgg gtgggcggtc aggtacgcgg acggggtcag cgaactgcct       840
     gtgggtgagc gggttcccac ggcgctggac acgatcttcg acttggcctc gatctcgaag       900
     ttgttcacct cgatcgtggt ggttcggcag gcggagctgg ggcgggtcgg gattgagcgg       960
     ccggttgccg agtacttgcc ggagttcggg gtggcaggca agggggacat cacggtccgg      1020
     cagttgctca cgcacacctc cgggctggcc gcgtggttgc cgttgtggtc ggggtggccg      1080
     gatcgggact cgcggatcaa ggcggtcatg gacgtcgcgc ctgcccgcgc acccggcacg      1140
     ggttacctgt actcggatct gaacctcatc acgctgggcg tgctggtcga gcgggtgtcc      1200
     gggatgccgc tggacgcctt ggtgcgcgag acgatcaccg agccgctggg gctggtcgac      1260
     accggctaca accccccgcc cgagaagctc ggtcggatcg ccgccaccga gttccagacc      1320
     tccccgcctc gcgggatcgt ccggggctcg gtgcacgacg agaacgcctg gtcgctgggc      1380
     ggcgtcgccg ggcacgcggg ggtgttctcc acggctcggg agctggccgt gctcggtcag      1440
     gcgatcctga acggcggggc ttaccggggc aagcgcatcc tcagcgagga atcggtgacc      1500
     gggatgctca ccaacctgac gcccgagttc cccggcaact cgcacggcct cgggttcgag      1560
     ctggacaccc gctggtacat gggcgccctg tccgccccgc gcacggcggg ccacaccggg      1620
     ttcaccggca ccacgatggt gctggacccg gcgtcccggt cgatcgcgct gctgctcacc      1680
     aaccgggtgc acccgagccg cgaccggggg tcgatcaacc cggcccgccg agcggtggcg      1740
     tccgggctgg ccgaggcgct ggcggtcggg ccggtgcgcg ggcggtcggc gtggcgcggc      1800
     gaccccggcg ggacgctgac caccaaaccc ctgcccgacg ggccgaaggt gctgcggttc      1860
     agcgcgttca ccgacctgga cgcgggcgag tcggtcgccg tgcaggagtt cgacggctcg      1920
     ggctggcggg acctgcgggt gctcaccggg gccgggacgc gcacctggga gcgggtcgag      1980
     ctgccgatga ccggcacggc cgcgcggtgg gtgcgctcgg gcgtgggcgc gaacggcgcg      2040
     cggggcgggt acgtggacgc gatcgaggtg gtcgcgggcc gccgggtgct gctggacggc      2100
     gagcgcggaa cgggcgaggt gaccgcctcc gggtggcgcg ccgtggaccg ttag            2154
//

If you have problems or comments...

PBIL Back to PBIL home page