(data stored in ACNUC7421 zone)

EMBL: CP001630.PE266

CP001630.PE266       Location/Qualifiers
FT   CDS_pept        complement(294549..295880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34240"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA8"
FT                   /inference="protein motif:PFAM:PF07075"
FT                   /protein_id="ACU34240.1"
FT                   /translation="MERRRFLAAGAVGVGTAVFGGAASSGAGAEPGGAGAGGAGGFGPG
FT                   GVGPEDVGQGGTDQNAVVRTGAEQLAGRGWRELAGRRVGVLTNPTGVLVDQTHVVDSMV
FT                   AAGVSPVAVFGPEHGFRGTAQAGGSEGDYLDPRTNIPVYDAYGADATKLAGLLTKAGVE
FT                   HVVFDIADIGARFYTYIWSMYTAMQAAARVGARFTVLDRPNPVGGEAHGPQLDPAYATG
FT                   VGRKPIVQQHGMTVGELAGFFNAEFLPSDGGAVVDLRVVEVRGWRRSRLDTGLPWVPPS
FT                   PNVPTRDTALVYPGTCLFEGLVFSEGRGTTRPFETIGAPGLDWRWAEDLNARGLPGVRF
FT                   REAHFTPWFGKFANTACSGVALQVTDPGRFDAIRTAVEMIVVARSRYPAVFAWRPDNWI
FT                   DKLSGSDRLRRMVGAGAGADEVVGAWSAELSTFRTRRRRHLRYR"
     gtggagcgga ggcgcttcct ggccgccggg gcggtcgggg tgggcacggc ggtgttcggt        60
     ggggccgcgt cgagtggggc gggcgcggaa ccgggtggtg cgggggccgg cggtgcgggt       120
     ggttttgggc ccggtggtgt ggggccggag gacgttggcc aaggcggcac cgaccagaac       180
     gcggtggtgc ggaccggggc ggagcagtta gccgggcggg ggtggcggga gctggctggg       240
     cggcgggttg gggtgttgac caatccgacc ggtgtcctgg tcgaccagac gcacgtcgtg       300
     gactcgatgg tcgcggcggg tgtgtcgccg gtggcggtgt tcgggcccga gcacgggttt       360
     cggggcacgg ctcaggcggg tggttccgag ggggactacc tggacccgcg cacgaacatc       420
     ccggtgtacg acgcgtacgg ggcggacgcc acgaagctcg ccgggctgct caccaaggcg       480
     ggggtcgagc acgtggtgtt cgacatcgcc gacatcggcg cccggttcta cacctacatc       540
     tggtccatgt acacggcgat gcaggcagcg gcccgcgtcg gcgcgcggtt caccgtgctc       600
     gaccggccca acccggtggg cggggaggcg cacgggccgc agctcgatcc cgcttacgcg       660
     accggggtgg ggcgcaagcc gatcgtgcag cagcacggga tgacggtggg cgagctggcc       720
     gggttcttca acgccgagtt cctgccgtcg gacggtggtg cggtggtgga cctgcgggtg       780
     gtcgaggtgc gggggtggcg caggtcgcgg ctggacaccg ggctgccgtg ggtgccgccg       840
     agcccgaacg tgccgacccg cgacaccgcg ctcgtctacc ccggcacctg cctgttcgag       900
     gggctggtct tctcggaggg gcggggcacg acccggccgt tcgagacgat cggcgcgccg       960
     gggctggact ggcgctgggc cgaggacctg aacgcgcgcg gcttgccggg ggtgcggttc      1020
     cgggaggcgc acttcacgcc gtggttcggc aagttcgcga acaccgcgtg ctccggggtc      1080
     gcgctgcagg tgaccgatcc gggcaggttc gacgcgatcc gcaccgccgt ggagatgatc      1140
     gtggtggccc gctcccgcta cccggccgtc ttcgcctggc ggccggacaa ctggatcgac      1200
     aagctgagcg gctcggaccg gctgcgccgc atggtcggcg cgggcgcggg cgccgacgag      1260
     gtcgtgggcg cctggtcggc cgagctgtcc acgttccgca cgaggcgccg ccgccacctg      1320
     cgctaccggt ag                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page