(data stored in ACNUC7421 zone)

EMBL: CP001630.PE268

CP001630.PE268       Location/Qualifiers
FT   CDS_pept        complement(296355..298097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0273"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: bha:BH0675 beta-hexosamidase A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34242"
FT                   /db_xref="GOA:C6WFB0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB0"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACU34242.1"
FT                   /translation="MHRLSRTLLTAAVVASSTAALPSAHAARPEPPAPQSVTSLVRGMS
FT                   LEEKVGQLFVTYVHGQSADEVHPGNLRDFGVDTPAQVVTRYRPGGVIYFNNSSYDNIDT
FT                   PAQIAALSNGLQQASRVPLTISTDQEMGIVTRIGPPLTQFPGSMALGAGRDERAAERAA
FT                   SVTARELRALGITQNFAPDADVNSNPANPVIGVRSFSSDPDLAATMVAAQVRGYQQRHL
FT                   SRTAVSAAAKHFPGHGDTADDSHTSLPTVDRTVEQWREVDAKPFRAAIAAGVDSIMTAH
FT                   IRMPAIDPSGEPATLSKPVVTGLLREELGYDGVVITDSLAMAGVRQLHTDAEIPVLALK
FT                   AGVDQLLMPVKLGEAIDAVVAAVRAGELSERRIDQSVLRVLRMKFLRGALPVWPVPPNP
FT                   VVGTPDRLAQAQEVADRAVTVVRDDAGVVRAGRVSGSVLVTGWGETTTAALAERLRARG
FT                   ATPQVVVTGSAPNEQQIAGAVSAAGGVGAVVVLTNALSRQPAQRALVDRLVASGKPVVA
FT                   VAVQNPYDVAHSNAQAWLATYSYGAVAMESVARVLSGEVRPVGRLPVDVPGPVAYPLGH
FT                   GLSW"
     gtgcaccgcc tcagccgcac cctcctgacc gcggccgtgg tcgcgtcgtc gaccgcagcc        60
     ctcccgagcg cgcacgccgc gcgacccgag ccgccggcgc cgcagtcggt gacctcgctg       120
     gtgcgcggca tgtcgctgga ggaaaaggtc ggccagctgt tcgtcaccta cgtgcacggg       180
     cagtccgccg acgaggtcca ccccggcaac ctgcgggact tcggcgtcga caccccggcc       240
     caggtggtga ccaggtaccg tcccggcggc gtcatctact tcaacaactc cagctacgac       300
     aacatcgaca cgcccgcgca gatcgccgcg ctgtccaacg gcctgcagca ggcctcgcgc       360
     gtcccgctga ccatctccac cgaccaggag atgggcatcg tgaccaggat cgggccgccg       420
     ctgacccagt tccccggcag catggcgctg ggcgcgggcc gggacgagcg ggcggccgag       480
     cgggcggcgt cggtgaccgc gcgcgagctg cgggcgctgg gcatcacgca gaacttcgcg       540
     ccggacgcgg acgtgaactc caacccggcg aacccggtga tcggggtgcg gtcgttctcc       600
     tcggacccgg acctggcggc cacgatggtg gcggcgcagg tgcgcggcta ccagcagcgg       660
     cacctgtcgc ggacggcggt gtcggcggcg gccaagcact tccccggcca cggcgacacg       720
     gccgacgaca gccacaccag cctgccgacc gtggaccgca cggtggagca gtggcgggag       780
     gtggacgcga agccgttccg cgcggcgatc gcggcgggcg tcgactcgat catgaccgcg       840
     cacatccgga tgcccgcgat cgacccgtcg ggggagccgg cgacgctgtc caagccggtg       900
     gtgaccgggc tgctgcgcga ggagttgggc tacgacggcg tggtgatcac cgactcgctg       960
     gcgatggcgg gcgtgcggca gctgcacacc gacgcggaga tcccggtgct ggcgctcaag      1020
     gccggggtcg accagctgct gatgccggtg aagctgggcg aggcgatcga cgccgtggtg      1080
     gcggcggtgc gcgcgggcga gctgtcggag cggcggatcg accagagcgt gctgcgggtg      1140
     ctgcggatga agttcctgcg tggcgcgctg ccggtgtggc cggtgccgcc gaacccggtg      1200
     gtgggcacgc cggaccggct cgcgcaggcg caggaggtcg cggaccgggc ggtaacggtg      1260
     gtgcgggacg acgcgggcgt ggtgcgggcc gggcgggtgt cagggtcggt gctggtgacg      1320
     ggctggggtg agacgacgac ggcggcgctg gccgagcggc tccgggcgcg cggggcgacg      1380
     ccccaggtcg tggtgaccgg gtcggcgccg aacgagcagc agatcgccgg ggcggtgtcc      1440
     gcggcgggcg gggtgggcgc ggtggtggtg ctgaccaacg cgctgtccag gcagcccgcg      1500
     cagcgcgcgc tggtggaccg gctggtggcg agcgggaaac cggtggtggc ggtggcggtg      1560
     cagaacccgt acgacgtggc gcactcgaac gcgcaggcgt ggctcgcgac ctactcgtac      1620
     ggggcggtgg cgatggagtc ggtggctcgg gtgctgagcg gggaggtccg gccggtcggg      1680
     cggctcccgg tggacgtgcc ggggccggtg gcttatccgt tagggcacgg gttgagctgg      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page