(data stored in ACNUC7421 zone)

EMBL: CP001630.PE269

CP001630.PE269       Location/Qualifiers
FT   CDS_pept        complement(298682..299494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0274"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); KEGG: pap:PSPA7_0428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34243"
FT                   /db_xref="GOA:C6WFB1"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB1"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ACU34243.1"
FT                   /translation="MTDPAAEGTRVAAFFDLDKTVIAKSSTLAFSRPFFQEGLINRRAV
FT                   LKSAYAQFVFMLAGADDDQMDRMRSHITALCSGWDVEQVRSIVEETLHDIVDPLVYKEA
FT                   TQLISDHKAQGHDVVVVSASGEELVSPIAQMVGADLSVGTRMVTSSGRYSGEVDFYCAG
FT                   ENKAVMVKQLAAERGYDLERCHAYSDSVSDLPLLEAVGHPTAVNPDRGLRKAATQRGWP
FT                   VLAFTDPVSLRARISRPSGAAVAVTAIGLGATVAAGAAWYGLRRRRRS"
     gtgaccgatc cagccgccga gggcacccga gtcgccgcgt tcttcgacct ggacaagacc        60
     gtcatcgcca agtcgagcac cctcgcgttc agcaggccct tcttccagga gggcctgatc       120
     aaccgccggg cggtgctcaa gagcgcctac gcgcagttcg tcttcatgct cgcgggcgcc       180
     gacgacgacc agatggaccg gatgcgctcc cacatcaccg cgctctgctc cggctgggac       240
     gtggagcagg tccgctcgat cgtggaggag acgctgcacg acatcgtcga cccgctcgtc       300
     tacaaggagg cgacgcagct catctccgac cacaaggcgc aggggcacga cgtggtcgtg       360
     gtgtccgcgt ccggcgagga gctggtgtcc cccatcgccc agatggtcgg cgccgacctg       420
     agcgtgggca cccggatggt gacgtcctcc ggccggtact ccggcgaggt ggacttctac       480
     tgcgcgggcg agaacaaggc cgtcatggtc aagcagctcg ccgcggagcg cggctacgac       540
     ctggagcgct gccacgccta ctcggactcg gtgagcgacc tgccgctgct ggaggcggtc       600
     gggcacccga cggcggtcaa cccggaccgg gggctgcgca aggccgcgac ccagcggggg       660
     tggccggtgc tggcgttcac ggacccggtg tcgctgcggg cgcgcatctc ccggccgtcc       720
     ggcgcggcgg tggcggtgac cgcgatcggg ctgggcgcga cggtcgccgc gggcgccgcc       780
     tggtacgggc tgcgccggag gcggcggagc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page