(data stored in ACNUC7421 zone)

EMBL: CP001630.PE27

CP001630.PE27        Location/Qualifiers
FT   CDS_pept        complement(29891..31153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0027"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: eba:ebA2155 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34001"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI0"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU34001.1"
FT                   /translation="MGLVQRFERRLEGMVGDTFARVFGGNVVSQEVAQALQREADGNIR
FT                   ELAGGRLLAPNHYVVLLGPEDHDRLAGDGQDELRITKSLGDSIQEHLEESGWDTYGDVV
FT                   VSLERSDALHTGQFRTRSSVDPDVKVDSRRSAPPRTAGDGSMSQPPGYGQGQGQPGYDP
FT                   YAQGGYGGQQPGYDQQGYGQGGQQQGYGQGQQGYDQQGYGQGGQQPGYDQGYGQGGQPG
FT                   YGQGQQGYDQGYGQGGYGGQQPGYDQQGYAGGQQPGYGQGQQGYDQGYGQGGAGYDQGG
FT                   QAGYGQQAAGYDQAGYGQQAAGYDQGYGQQAGYGGAPAGGAQRQLSATLHLDDGSNRTY
FT                   NLKQGGNVVGRGQEADFRLPDTGVSRRHLEITWDGHSAMLADLGSTNGTTVNGTPVQTW
FT                   QLAEGDVVRIGHSSLVFRTQG"
     gtgggcctcg tacagcgctt cgagcgccgt ctcgaaggca tggttggcga caccttcgcc        60
     agggtgttcg gcggcaacgt cgtctcgcag gaagtggccc aggccctcca gcgggaggcg       120
     gacgggaaca tccgggagct ggcgggcggg cggctgctgg cccccaacca ctacgtggtc       180
     ctgctcggcc ctgaggacca cgacaggctt gccggtgacg gccaggatga actacgcatc       240
     accaagtccc tgggcgactc catccaggag cacctggagg agagcggatg ggatacctat       300
     ggtgacgtcg tagtctccct ggagcgctcc gacgcgctgc acaccggtca gttccgaacc       360
     cgctcgtccg tcgaccccga cgtgaaagtt gacagccgac ggtcagcacc acctcgcact       420
     gcaggagacg gatcaatgag ccagcctccc ggctacggac aaggacaggg ccagcccggc       480
     tacgacccct acgcgcaggg cggctacggc ggtcagcagc ctggctacga ccagcagggc       540
     tacggccaag gtggtcagca gcagggctac ggccagggcc agcagggcta cgaccagcag       600
     ggctacggcc aaggcggtca gcagcccggc tacgaccagg gctacggcca gggcggtcag       660
     cccggctacg gccagggcca gcagggctac gaccagggct acggccaggg cggctacggc       720
     ggtcagcagc ccggctacga ccagcagggc tacgcgggcg gtcagcagcc cggctacggc       780
     cagggccagc agggctacga ccagggctac ggccagggcg gcgcaggcta cgaccagggc       840
     ggccaggccg gttacggcca gcaggcggcg ggctacgacc aggcgggcta cggccagcag       900
     gccgcgggct acgaccaggg ctacggccag caggcgggct acggcggcgc cccggcgggc       960
     ggcgcgcagc gccagctgag cgcgaccctg cacctggacg acgggtccaa ccggacctac      1020
     aacctgaagc agggcggcaa cgtggtcggc cgcggccagg aggccgactt ccggctcccc      1080
     gacaccggcg tctccaggag gcacctggag atcacctggg acgggcacag tgccatgctc      1140
     gccgatctcg gctcgaccaa cggcacgacg gtgaacggga ccccggtgca gacctggcag      1200
     ctcgcggaag gcgacgtcgt ccgcatcggc cactcgtcgc tggtcttccg cacacagggc      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page