(data stored in ACNUC7421 zone)

EMBL: CP001630.PE270

CP001630.PE270       Location/Qualifiers
FT   CDS_pept        299900..301015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_2914 Flp pilus assembly protein
FT                   ATPase CpaE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34244"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34244.1"
FT                   /translation="MVIMRPLCPRSPGTTVLHVGFDESGERDVGRSVVLVDGAELLDEV
FT                   LRLAAVAECELERVVDVTALRGRWHDAPVVLLDERAVVACAEAGLPRRPGVLLVSTGPP
FT                   GELTWPRAVELGVERAVSADAGLVALLRDATEVAPEAGRVLAVLGGRGGAGASVLAAAV
FT                   ARAVAASGGPSLLVDCDPLGGGLDLALGAETSAGMRWSDLDLSGRVPAAALRQVLPACG
FT                   GVRVLSCGRDGEGPGAGAVASVVEAGRRSGQVVVCDLPRQRTPAADAALDRADLAVLVV
FT                   PAEVRACAAARGVARRLAERGARTRALVRVRASGGLSAQEVAAAVGVPLLTRMRGQRQL
FT                   ASALDRGRFPTSTRGPLAKAATTVLEVLRAG"
     atggtgatca tgcgcccgtt gtgtcctcgc tcaccgggga cgaccgttct ccacgtgggc        60
     ttcgacgaga gcggggagcg ggacgtgggg cgatctgtgg tcctggtgga cggggccgag       120
     ctgctggacg aggtgctgcg gctggcggcc gtcgccgagt gcgagctgga gcgggtggtg       180
     gacgtgaccg ccctgcgcgg ccggtggcac gacgcgccgg tggtgctgct ggacgagcgc       240
     gcggtggtgg cgtgcgcgga ggcggggctg ccgcgcagac cgggggtcct gctggtgtcg       300
     accggcccgc cgggcgagct gacctggccc agggcggtcg agctgggcgt ggagcgggcg       360
     gtgtcggcgg acgccgggct ggtggcgctg ctgcgcgacg cgaccgaggt ggcgccggag       420
     gccgggcggg tgctggccgt gctcggcggc cggggcggtg cgggcgcgtc ggtgctcgcg       480
     gcggccgtgg ccagggccgt cgccgcctcg ggcggtccgt cgctgctggt cgactgcgac       540
     ccgctgggcg gtggcctcga cctcgcgctg ggcgccgaga ccagcgcggg gatgcgctgg       600
     tccgacctcg acctgtccgg ccgggtcccg gccgccgcgc tgcgccaggt gctgcccgcg       660
     tgcggcgggg tgcgggtgct gtcctgcggc cgggacggcg aggggccggg cgcgggcgcg       720
     gtggcgtccg tggtcgaggc gggccgcagg tcggggcagg tggtggtgtg cgacctgccc       780
     cgccagcgga ccccggcggc ggacgcggcc ctggaccgcg ccgatctggc cgtgctggtg       840
     gtgcccgccg aggtgcgggc ctgcgcggcg gccaggggcg tggcccgcag gctggccgag       900
     cggggcgcgc gcacccgagc gctcgtgcgg gtgcgggcct ccggcgggtt gagcgcccag       960
     gaggtggccg ccgccgtggg cgtgccgctg ctgacccgga tgcgcggtca gcgccaactg      1020
     gcctcggcac tggaccgggg ccgcttcccg acgtcgaccc gaggcccgct cgcgaaggcg      1080
     gcgaccacgg tcctggaggt gctccgtgcg ggctga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page