(data stored in ACNUC7421 zone)

EMBL: CP001630.PE271

CP001630.PE271       Location/Qualifiers
FT   CDS_pept        301321..302439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0276"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   bav:BAV2285 pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34245"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB3"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACU34245.1"
FT                   /translation="MGADLVERVRRRLAEGRAELTPSAVAAAVRGEAGGVLGDEEVLRA
FT                   MSELGREFAGAGLLEPLLRAPGTTDVLVTAPDQVWVDGEDGLRRADVVFPDERAVRRLA
FT                   QRLAVAAGRRLDEAVPHVDGWLPGAVRLHAVLPPITRNTCLSLRVLRPATHDLAELRAR
FT                   GAFSAEVAEALRALVRSRTAFLVVGGTGSGKTTLLAALLGCVPHDQRVVCVEDAGELEP
FT                   DHPQVVRLVARAANVEGAGEVTVRDLVRQALRMRPDRIVVGEVRGAEVCDLLSALNTGH
FT                   EGGAGTLHANSPAEVPARLEALAALGGLDRVALHSQVLAALRAVLHVRRTPEGRRLVEI
FT                   GVFERAAGDLRVVPVWRHDTGWRNRALLESSR"
     gtgggcgctg atctggtgga gcgggtccgg cgcaggctcg ccgagggccg cgccgagctc        60
     accccgtcgg cggtcgcggc ggcggtgcgc ggtgaggcgg gcggggtgct cggcgacgag       120
     gaggtcctgc gcgccatgtc cgagctgggc cgcgagttcg cgggcgcggg cctcctcgaa       180
     ccgctgctgc gcgcgcccgg aacgacggac gtgctggtca ccgccccgga ccaggtgtgg       240
     gtcgacggcg aggacggcct gcgccgcgcc gacgtggtgt tccccgacga gcgggcggtc       300
     cgcaggctcg cccagcggct ggccgtggcg gcgggcaggc gcttggacga ggcggtgccg       360
     cacgtggacg gctggttgcc cggcgcggtc cgcctgcacg ccgtgctgcc gccgatcacc       420
     cggaacacct gcctgtccct gcgcgtcctg cgcccggcga cgcacgacct ggcggagctg       480
     cgggccaggg gcgcgttcag cgcggaggtg gccgaggcgc tgcgcgccct ggtccgctcc       540
     cgcaccgcgt tcctggtggt gggcgggacg gggtcgggca agaccaccct gctggccgcg       600
     ctgctcggct gcgtcccgca cgaccagcgg gtggtgtgcg tggaggacgc gggcgagctg       660
     gaacccgacc acccgcaggt ggtccgcctg gtggcgcggg cggcgaacgt ggagggcgcg       720
     ggcgaggtga ccgtccggga cctggtccgc caggcgctgc ggatgcgccc ggaccgcatc       780
     gtggtcggcg aggtgcgcgg agccgaggtc tgcgacctgc tcagcgcgct gaacaccggc       840
     cacgagggcg gcgcgggcac cctgcacgcg aactccccgg ccgaggtccc ggcccgcctg       900
     gaagccctgg ccgcgctcgg cggcctggac cgggtggcgc tgcacagcca ggtgctggcg       960
     gcgctccggg ccgtcctgca cgtccgcagg accccggagg gccgtcgcct ggtggagatc      1020
     ggcgtgttcg agcgcgcggc gggcgacctc cgcgtggtcc cggtctggcg ccacgacacc      1080
     ggctggcgga accgcgcgct gctggagtcg agccgatga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page