(data stored in ACNUC7421 zone)

EMBL: CP001630.PE272

CP001630.PE272       Location/Qualifiers
FT   CDS_pept        302579..303334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0277"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   acp:A2cp1_3010 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34246"
FT                   /db_xref="GOA:C6WFB4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB4"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACU34246.1"
FT                   /translation="MSLLLFAAAVLLLPSTARGRLEALRGKRKPRVTFRPTTPLVVGAG
FT                   ALLGLLLGPAGAVSGAVLAAVLWRAHRVRAAHRADLLAADALAEGLRSFTTELRTGAHP
FT                   AGAALAAARDAAEPAATVLTAIATSTSRGGDVVSALAGTPAARLARAWRLADHHGVPLA
FT                   EVLDTARADLERRTAFTRTVHARMAGPRTSAAVLAALPVLGVLLGQLSGTSPLSILRDT
FT                   LPGQALLLVGVLLLVVGLRWSAGLTGSAA"
     atgagcctgc tgctgttcgc ggcggccgtg ctgctcctgc cgtccaccgc ccgaggacgc        60
     ctggaagcct tgcgcggcaa gcggaaaccc cgcgtcacct tccgcccgac cacaccgctg       120
     gtcgtgggcg cgggcgcgct gctgggcctg ctcctgggcc cggcgggtgc ggtgtcgggc       180
     gcggtgctgg ccgctgtcct gtggcgcgcg caccgcgtcc gagccgctca ccgggctgac       240
     ctgctggcgg ccgacgcgct ggcggagggc ctgcgctcgt tcaccaccga actgcgcacc       300
     ggcgcccacc cggcgggtgc ggcgctggcg gcggcccggg acgcggcgga gcccgcggcg       360
     accgtgctga ccgcgatagc gacgtccacc tccaggggag gcgacgtggt gtccgcgctg       420
     gcgggcaccc cggccgcccg cctggccagg gcgtggcgcc tcgcggacca ccacggcgtg       480
     ccgctggccg aggtgctcga caccgcccgc gcggacctgg agcgcaggac cgccttcacc       540
     cggaccgtcc acgcccggat ggccggtccg aggacgagcg ccgcggtgct ggccgcgctg       600
     ccggtgctcg gggtcctgct ggggcagctg tccggcacgt ccccgctgtc gatcctgcgc       660
     gacaccctgc cgggacaagc gctcctgctg gtgggcgtgc tgctcctggt ggtgggtctg       720
     cgctggagcg ccggtctgac cgggagcgcc gcatga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page