(data stored in ACNUC7421 zone)

EMBL: CP001630.PE273

CP001630.PE273       Location/Qualifiers
FT   CDS_pept        303331..303888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0278"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG: Hcn2;
FT                   hyperpolarization activated cyclic nucleotide-gated
FT                   potassium channel 2; K04955 hyperpolarization activated
FT                   cyclic nucleotide-gated potassium channel 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34247"
FT                   /db_xref="GOA:C6WFB5"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB5"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACU34247.1"
FT                   /translation="MSFLLLALAVLILPGGRSPCARLRPPVQPIAKPRRAKRSPPDPLA
FT                   LAETWDLFAAALRSGLPVPSALHAVLPGTPPGPAERLGQVRDLLALGADPATAWDPALD
FT                   HPATAPLARSARRTARSGAALADQVADLAARLRASAADDAESRAQRAAVLVAGPLSLCF
FT                   LPAFLCLGVAPVLIGIASGLNR"
     atgagcttcc tgctgctggc gctggccgtg ctgatcctgc cgggcgggcg ctccccgtgc        60
     gcccgcctgc gcccacccgt ccagccgatc gcgaaacccc ggcgtgccaa gcgatcccca       120
     ccggatccgc tggcgctggc cgagacctgg gacctgttcg cggcggcgct gcgctcgggt       180
     ctcccggtgc cgagcgcgct gcacgccgtc ctgccgggaa ccccgccggg tccggcggag       240
     cgcctcgggc aggtccgcga cctgctggca ctgggcgcgg acccggcgac ggcctgggac       300
     ccggccctgg accacccggc caccgcgccg ctcgccaggt cggcgaggag aaccgcccgt       360
     tcgggtgcgg cgctggctga ccaggtggcc gacctggcgg cgcggctccg ggcgagcgcc       420
     gccgacgacg cggagagcag ggcccagcgg gcggcggtcc tggtggccgg cccgctgtcc       480
     ctgtgcttcc tgcccgcgtt cctgtgcctg ggggtggcgc cggtcctgat cggcatcgcc       540
     tccggattga accgctga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page