(data stored in ACNUC7421 zone)

EMBL: CP001630.PE274

CP001630.PE274       Location/Qualifiers
FT   CDS_pept        303910..304065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34248"
FT                   /db_xref="GOA:C6WFB6"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34248.1"
FT                   /translation="MLDDRGVATLEYAFCALCAAAFAGVLYVVISQGWAANALKTILDR
FT                   ALAGAT"
     gtgctggatg accgaggtgt ggccacgctg gagtacgcct tctgcgccct gtgcgcggcg        60
     gctttcgcgg gcgtcctgta cgtcgtgatc tcccagggct gggccgcgaa cgccctgaag       120
     acgatcctgg accgagcact ggcgggggcg acatga                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page