(data stored in ACNUC7421 zone)

EMBL: CP001630.PE276

CP001630.PE276       Location/Qualifiers
FT   CDS_pept        304605..304934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_2535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34250"
FT                   /db_xref="GOA:C6WFB8"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34250.1"
FT                   /translation="MRLGDRGSASVLGAVLVVVLVSLAVLGVQFGAAVVVRHRVVAAAD
FT                   LAALAAAGRLLEGDGVACGWAERVVREMGAVLERCSVREWEVAVSVSGPANLFGTPVGR
FT                   ARAGP"
     atgcgtcttg gggaccgggg gtcggcctcg gtgctgggcg cggtgctggt ggtggtgctg        60
     gtgtcgttgg ccgtgctcgg cgtgcagttc ggtgcggcgg tcgtggtgcg acaccgggtg       120
     gtcgcggctg ctgatctcgc tgcgcttgcc gcagccgggc ggttgctgga gggggacggc       180
     gtggcttgtg ggtgggctga gcgggttgtt cgggagatgg gggcggtgct ggagcggtgt       240
     tcggtgcgtg agtgggaggt ggctgtttcg gtgtccgggc ccgccaacct gttcggcacg       300
     cccgtcgggc gcgcccgagc tgggccctga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page