(data stored in ACNUC7421 zone)

EMBL: CP001630.PE277

CP001630.PE277       Location/Qualifiers
FT   CDS_pept        305305..305910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0282"
FT                   /product="Bifunctional DNA primase/polymerase"
FT                   /note="PFAM: Bifunctional DNA primase/polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34251"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB9"
FT                   /inference="protein motif:PFAM:PF09250"
FT                   /protein_id="ACU34251.1"
FT                   /translation="MEWSESWRGAFRIELRAEAVNLAWHGWPVLPGTYPSGDGWLGRDQ
FT                   VEASGPVPVHADWRERIGTLPEQVATWWTGGSYTILLATGHGVDAVEVNAELGKRAAVA
FT                   LRTAGAPAPIVATPDGRWMFLVRSGGVVREDLAARGVVHRTRGEHITLPPSPARHGVVH
FT                   WRVKPQVCGWQLPEPGTVLDAIGSALAVRHDGLVALES"
     atggagtggt cggagagctg gcgcggagcg ttccgcatcg agctgcgcgc ggaggcggtc        60
     aacctcgcgt ggcacggctg gccggtgctc cccggtacct acccctcggg tgacggctgg       120
     ctcgggcgcg accaggtcga ggcgagcggg cccgttccgg tgcacgccga ctggcgcgag       180
     cggatcggca cgctgcccga gcaggtcgcc acctggtgga ccggcgggtc ctacacgatc       240
     ctgctcgcca ccgggcacgg cgtggacgcc gtcgaggtga acgccgagct gggcaagcgg       300
     gccgccgtcg cgctgcgcac cgccggtgct cccgcgccga tcgtggccac tccggacggg       360
     cggtggatgt tcctggtgcg gtccggcggt gtggtccggg aggacctcgc cgcgcgcggc       420
     gtcgtccacc ggacgcgcgg cgagcacatc acgctcccgc cctcgcccgc gcggcacggg       480
     gtcgtgcact ggcgggtcaa gccgcaggtg tgcgggtggc agctccccga gcccggcacc       540
     gtgctcgacg ccatcggctc cgccctggcc gtgcgccacg acgggctcgt cgctctcgag       600
     tcctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page