(data stored in ACNUC7421 zone)

EMBL: CP001630.PE278

CP001630.PE278       Location/Qualifiers
FT   CDS_pept        complement(306276..308699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0283"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: dvu:DVU0256 DEAD-box ATP
FT                   dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34252"
FT                   /db_xref="GOA:C6WFC0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC0"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACU34252.1"
FT                   /translation="MANQGRRLLDRVLAGVPLGEAPLTHAEELPGQDAREVPWPSWAAP
FT                   EVVSALVERGVPAPWSHQAQAAELAWSGRDVVVATGTASGKSLAYQLPVLSALVAEGRA
FT                   TALYLSPTKALGADQIRAVEELAVPGVRAASFDGDTAMDERDWVRAHANWVFSNPDMLH
FT                   RGVLPNHARWIRFFRGLAYVVVDECHAYRGVFGSHVALLLRRLRRVARRYGADPVFVLA
FT                   SATVAEPAASAERLVGKPCAAVVEDGSPRAGRVVALWEPPLLSELEGENGAPVRRSAGA
FT                   ETARILADLVVEGARSLAFVRSRVGAELTAMGARRVLAEVDPELPGRVAAYRGGYLPEE
FT                   RRALERALASGDLLGVATTNALELGVDIAGLDAVVVAGFPGTLASFWQQAGRAGRSGGD
FT                   SLVVFVARDDPLDTYLAHHPEAVLRRPVEATVLDPSNPYVLAPHLACAAAELPLTEECL
FT                   AGFGEGAREVVDGLVADRVLRRRPNGGWYWTARERPQGQVDIRGSGGEQVVVVEGDTGR
FT                   VLGTVDPAAAHWTVHEGAVYLHQGESYVVDSLDLEAGIALVRAERPDWSTTARDTKDIV
FT                   VVRVEQERRFAGVRVCLGEVEVTSQVVSYLRKLPSGQVVDQVPLDLPAQVLRTRAVWYA
FT                   VDDSLLGSAPGGAGLAPATVPGALHAAEHAAIGLLPLFATCDRWDIGGVSTALHQDTGE
FT                   ATVFVHDGHPGGAGFADRGFAAVVPWLAAAREAISSCACPAGCPSCVQSPKCGNGNDPL
FT                   DKAGGAAVLDVVLRAVENPPSDAQPDRLGGSGGAGGSGAGGSGSGLAGEAGTAR"
     gtggcgaacc agggacgtcg actgctggac cgggtgctcg ccggggttcc gctcggcgag        60
     gccccgctga cgcacgccga ggagctgccc ggccaggacg cgcgggaggt cccgtggccg       120
     tcctgggcgg cccccgaggt ggtgtccgcg ctggtggagc ggggtgtgcc cgcgccgtgg       180
     tcgcaccagg cgcaggcggc ggagctggcg tggtcggggc gggacgtggt ggtggcgacc       240
     ggcaccgcgt cgggcaagtc gctggcctac cagctgccgg tgctgagcgc gctcgtggcg       300
     gaggggcggg caactgctct gtacctgtcg ccgacgaagg cgctgggggc ggaccagatc       360
     cgcgcggtgg aggagctggc ggttccgggc gtgcgggcgg cctcgttcga cggggacacc       420
     gcgatggacg agcgggactg ggtgcgggcg cacgcgaact gggtgttcag caacccggac       480
     atgctgcacc ggggcgtgct gccgaaccac gcgcggtgga tccggttctt ccgcgggctc       540
     gcgtacgtgg tggtggacga gtgccacgcg taccggggcg tgttcggctc gcacgtggcg       600
     ctgctgctgc ggcggttgcg gcgggtggcg cggcggtacg gggcggaccc ggtgttcgtg       660
     ctggcgtcgg cgaccgtggc cgagcccgcg gcgtccgcgg agcggctggt ggggaagccg       720
     tgcgcggcgg tggtggagga cgggtcgccg cgcgcggggc gggtggtggc gctgtgggag       780
     ccgccgctgc tgtccgagct ggagggtgag aacggcgcgc cggtgcggcg gtcggcgggc       840
     gcggagacgg cgcgcatcct ggcggacctg gtggtcgagg gggcgcggtc gctggcgttc       900
     gtgcggtcgc gggtcggggc ggagctgacc gcgatgggcg cgcggcgggt gctggccgag       960
     gtggaccccg agctgccggg gcgggtcgcc gcgtaccggg gcgggtacct gccggaggag      1020
     cggcgggcgc tggagagggc gctggcgagc ggggacctgc tcggggtggc gacgacgaac      1080
     gcgctggagc tgggcgtgga catcgccggg ctggacgcgg tggtggtggc cgggttcccc      1140
     ggcacgctgg cgtcgttctg gcagcaggcg gggcgcgcgg gccggtcggg cggggactcg      1200
     ctggtggtgt tcgtggcgcg ggacgacccg ctggacacgt acctggcgca ccacccggag      1260
     gcggtgctgc ggcggccggt ggaggcgacc gtgctggacc cgtcgaaccc gtacgtgctg      1320
     gccccgcacc tggcgtgcgc ggcggcggag ctgccgctga ccgaggagtg cctggcgggg      1380
     ttcggggagg gcgcgcgcga ggtggtggac gggctggtcg cggaccgggt gctgcggcgg      1440
     cggcccaacg gcggctggta ctggacggcg cgggagcgcc cgcaggggca ggtggacatc      1500
     cgggggtcgg gcggcgagca ggtcgtggtc gtggagggcg acaccgggcg ggtgctcggc      1560
     acggtcgacc cggcggcggc gcactggacg gtgcacgagg gcgcggtgta cctgcaccag      1620
     ggcgagtcgt acgtggtgga ctcgctggac ctggaggccg ggatcgcgct ggtgcgtgcg      1680
     gagcgcccgg actggagcac gacggcgcgg gacaccaagg acatcgtggt ggtgcgggtc      1740
     gagcaggagc ggcggttcgc cggcgtgcgg gtgtgcctgg gcgaggtgga ggtgacctcg      1800
     caggtggtgt cgtacctgcg gaagctgccg tccggccagg tggtcgacca ggtgccgctg      1860
     gacctgcccg cgcaggtgct gcgcacgcgg gcggtctggt acgcggtgga cgattcgttg      1920
     ctgggcagcg cgccgggagg cgccggtctg gctccggcga ccgtccccgg cgcgctgcac      1980
     gccgccgagc acgcggcgat cggcctgcta ccgctcttcg cgacctgcga ccggtgggac      2040
     atcggcgggg tgtcgaccgc gctgcaccag gacaccgggg aggcgacggt gttcgtgcac      2100
     gacggtcatc cgggtggagc cggattcgcc gaccgcggtt tcgccgcggt ggtcccgtgg      2160
     ttggccgcgg cgcgggaggc catctcctcg tgcgcgtgcc ctgcggggtg cccgtcctgc      2220
     gtgcagtcgc cgaagtgcgg caacggcaac gatccgctgg acaaggcagg tggcgcggcc      2280
     gtgctggacg tcgtcctcag agcggtggag aacccaccct ccgacgccca gcccgaccgg      2340
     ctgggtggtt ctggtggagc tggtggttct ggagctggtg gatctggttc tggtctggca      2400
     ggtgaagccg gcactgcgcg ttga                                             2424
//

If you have problems or comments...

PBIL Back to PBIL home page