(data stored in ACNUC7421 zone)

EMBL: CP001630.PE279

CP001630.PE279       Location/Qualifiers
FT   CDS_pept        308935..311295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0284"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: xcb:XC_0853 membrane-bound proton-
FT                   translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34253"
FT                   /db_xref="GOA:C6WFC1"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC1"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ACU34253.1"
FT                   /translation="MSRQFLAEGIELSGGDRGLVAAVAVVALAALVVGAVLLKEVLAAG
FT                   QGTAKMQDIAKAVQEGASAYLNRQFRTLGIFVVVVFALLFLLPAEDTGERIGRSLFFIV
FT                   GAVFSATIGYLGMWLSTRANVRVAAAAQAGQSGREKAMRVAFRTGGVVGMFTVGLGLFG
FT                   AAVVVLVYAGQAPRVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVEQNIPEDD
FT                   PRNAATIADNVGDNVGDCAGMAADLFESYAVTLVASLILGTAAFGSQGLLFPLIVPAIG
FT                   VVTAVIGVYITGARPGESGLSAINRSFYISAVISAVLCTAAAFAFLPGTFAELGGVSAE
FT                   IAATEGNPAVIAAAAVLIGIVLAGVILWLTGYYTGTEHKPVQEVGRTSLTGAATVILSG
FT                   ISLGFESAVYTALVIGGAVYGAFLLSGSVIVALFAVALAGCGLLTTVGVIVAMDTFGPV
FT                   SDNAQGIAEMSGDVDGEGAQVLTELDAVGNTTKAITKGIAIATAVLAAAALFGSYKDAI
FT                   EKALVEVGGVFEAQDFVAFTPNVLVGLVIGAAVVFMFSGLAVNAVTRAAGAIVFEVRRQ
FT                   FRDNPGIMDGTTKPEYGRVVDICTRDSLRELATPGLLAVMAPIAVGFGLGVGPLAGYLA
FT                   GAIATGTLMAVFLANSGGAWDNAKKLVEDGHHGGKGSDAHAATVIGDTVGDPFKDTAGP
FT                   AINPLIKVMNLVSVLIAPAVVTFSVGADASAPVRYGIAVFAVGVVVAAVVVSKRRGTVI
FT                   GDEPADPPSGSPSVPAQATVTDPVQARATGGTA"
     atgtcccggc aattcctcgc ggagggcata gagctctccg gaggtgatcg cggcctcgtg        60
     gccgcggtcg ccgtggtcgc cctggccgct ctcgtagtcg gagctgtcct gctcaaggag       120
     gtgctggccg cgggccaggg caccgccaag atgcaggaca tcgccaaggc ggtccaggaa       180
     ggcgcttctg cctacctcaa ccggcagttc cggaccctcg gcatcttcgt cgtcgtggtc       240
     ttcgccctgc tgttcctgct cccggccgag gacaccggcg agcggatcgg caggtcgctg       300
     ttcttcatcg tgggcgccgt gttctcggcg accatcggct acctgggcat gtggctgtcc       360
     acgcgcgcga acgtgcgcgt ggcggcggcg gcccaggccg gtcagagcgg gcgcgagaag       420
     gccatgcggg tggcgttccg caccggcggc gtggtcggca tgttcaccgt cggcctcggc       480
     ctgttcggcg ccgcggtcgt cgtgctggtc tacgcgggcc aggccccgag ggtcctggag       540
     ggcttcgggt tcggcgccgc gctgctggcc atgttcatgc gggtcggcgg cggcatcttc       600
     accaaggccg ccgacgtcgg ggccgacctg gtcggcaagg tcgagcagaa catcccggag       660
     gacgacccgc gcaacgccgc caccatcgcc gacaacgtcg gcgacaacgt gggcgactgc       720
     gcgggcatgg ccgccgacct gttcgagtcc tacgcggtca ccctcgtcgc ctcgctgatc       780
     ctcggcacgg cggcgttcgg ctcgcagggt ctgctgttcc cgctgatcgt gcccgccatc       840
     ggcgtggtca cggcggtcat cggcgtgtac atcaccggcg cccggccggg tgagagcggc       900
     ctgtcggcga tcaaccgctc gttctacatc tcggcggtca tctcggcggt gctgtgcacg       960
     gccgccgcgt tcgcgttcct gcccggcacg ttcgccgagc tgggcggcgt cagcgcggag      1020
     atcgccgcca ccgagggcaa cccggccgtg atcgccgccg ccgccgtcct catcggcatc      1080
     gtgctcgcgg gcgtcatcct gtggctgacg ggctactaca ccggcaccga gcacaagccc      1140
     gtccaggagg tcggccgcac ctcgctgacc ggcgcggcca ccgtgatcct gtccggcatc      1200
     tcgctcggct tcgagtccgc cgtgtacacc gcgctggtga tcggcggggc cgtgtacggc      1260
     gcgttcctgc tgtccggctc ggtgatcgtg gcgctgttcg cggtcgcgct cgccggctgc      1320
     ggcctgctga ccacggtcgg cgtcatcgtc gccatggaca cgttcggccc ggtctccgac      1380
     aacgcccagg gcatcgccga gatgtccggc gacgtcgacg gcgagggcgc tcaggtcctc      1440
     accgagctgg acgcggtcgg caacaccacc aaggccatca ccaagggcat cgcgatcgcc      1500
     actgcggtgc tcgccgcggc tgccctgttc gggtcctaca aggacgccat cgagaaggcg      1560
     ctcgtcgagg tcggcggcgt gttcgaggcg caggacttcg tggcgttcac gcccaacgtc      1620
     ctggtcggac tggtgatcgg cgcggccgtg gtgttcatgt tctccggcct cgcggtcaac      1680
     gcggtgaccc gcgcggcggg cgccatcgtg ttcgaggtgc gccgccagtt ccgcgacaac      1740
     cccggcatca tggacggcac caccaagccc gagtacggcc gcgtcgtgga catctgcacc      1800
     agggactcgc tgcgcgagct ggccacgccc ggcctgctcg cggtgatggc ccccatcgcg      1860
     gtcggcttcg gcctcggtgt cgggccgctc gcgggctacc tggcgggcgc gatcgccacc      1920
     ggcacgctga tggcggtgtt cctggccaac tccggtggcg cctgggacaa cgccaagaag      1980
     ctcgtcgagg acggccacca cggcggcaag ggctccgacg cgcacgccgc cacggtcatc      2040
     ggcgacaccg tcggcgaccc gttcaaggac accgccggtc ccgcgatcaa cccgctgatc      2100
     aaggtgatga acctggtctc ggtgctgatc gcgcccgccg tcgtgacgtt ctcggtcggc      2160
     gcggacgcct cggcccccgt ccgctacggc atcgcggtgt tcgccgtcgg cgtcgtggtc      2220
     gcggcggtcg tggtgtccaa gcggcgcggc acggtcatcg gcgacgagcc cgccgacccg      2280
     ccgtcgggct cgcccagcgt gcccgcgcag gcgaccgtca ccgaccccgt ccaggcgcgc      2340
     gccaccggcg gcaccgccta g                                                2361
//

If you have problems or comments...

PBIL Back to PBIL home page