(data stored in ACNUC7421 zone)

EMBL: CP001630.PE28

CP001630.PE28        Location/Qualifiers
FT   CDS_pept        31797..32417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34002"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34002.1"
FT                   /translation="MSSTPARIEVTDSAKAKATSAAAVPIPELPGSVEELATVAAVRLG
FT                   WHGVVLPEMVLMGRKVVVVADLIADAHAERLCLGAAPEVDRATVSTWVWPEMDGRVPPA
FT                   AVRIVGVLAVARHWRTALASAVPFARFGNAAAVLPASVALSHDYLANCLPRVRRYGVNV
FT                   LLADESSELTTDVCGRNETVPVEDTATTRWVNELVYERVLATA"
     gtgagcagca cacccgcacg gatcgaggtc acggactccg cgaaggcgaa ggccacgtcg        60
     gccgccgcgg tcccgatccc cgaactgccc ggctccgtcg aggagttggc cacggtcgcc       120
     gcggtccgcc tcgggtggca cggcgttgtg ctgccggaga tggtcctgat gggccgcaag       180
     gtcgtggtcg tcgccgacct gatcgccgac gcgcacgccg agcggctgtg cctcggcgcg       240
     gcccccgagg tcgaccgggc caccgtctcc acctgggtgt ggccggagat ggacggccgc       300
     gtgccgcccg ccgccgtgcg catcgtcggc gtgctggcgg tggccaggca ctggcgcacc       360
     gcgctggcct ccgccgtccc cttcgcgcgc ttcggcaacg ccgccgccgt gctgcccgcc       420
     tcggtcgcgc tgagccacga ctacctggcc aactgcctgc cgcgcgtgcg caggtacggc       480
     gtgaacgtgc tgctcgccga cgagagcagc gagctgacca ccgacgtctg cggtcgcaac       540
     gagaccgtgc cggtcgagga caccgccacc acccgctggg tcaacgagct ggtctacgag       600
     cgggtcctgg ccaccgcctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page