(data stored in ACNUC7421 zone)

EMBL: CP001630.PE280

CP001630.PE280       Location/Qualifiers
FT   CDS_pept        311416..312054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34254"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34254.1"
FT                   /translation="MRARLVTAVAASALSACLLAGCTGQDSEPTPTTSSTSTSASPEQL
FT                   AADYLDKVCSATSAFATVQKTPPGADVTDPGKRKELMAVYMGQFGEAFTRSATELRAVG
FT                   ESPVAGGDQVVEKMAATFSEMATVFTDAKSAVEQADANDQYGGLAPARDALAKLADFSV
FT                   PLKEVESTPELAAAARKAPKCQALRTATPSPSATAGAPAVESSVPPSTS"
     atgagagccc gcctcgtcac cgccgtcgcc gcctcggcgc tctccgcgtg cctgctcgcg        60
     ggctgcaccg ggcaggactc cgagccgacg ccgaccacga gcagcacgtc cacctcggcc       120
     tcgccggagc agctggccgc cgactacctg gacaaggtgt gctcggcgac ctcggcgttc       180
     gccaccgtgc agaagacccc gccgggcgcg gacgtcaccg accccggcaa gcgcaaggag       240
     ctgatggccg tctacatggg ccagttcggc gaggcgttca ccaggagcgc gaccgagctg       300
     cgggccgtcg gcgagtcgcc ggtcgcgggc ggggaccagg tcgtggagaa gatggcggcc       360
     accttcagcg agatggccac ggtgttcacc gacgccaagt ccgccgtgga gcaggccgac       420
     gcgaacgacc agtacggcgg cctcgcgccc gccagggacg cgctcgccaa gctcgcggac       480
     ttcagcgtgc cgctgaagga ggtcgagtcc acgccggagc tggccgccgc cgcgcgcaag       540
     gccccgaagt gccaggcgct gcgcaccgcc accccgtcgc cctccgcgac cgcgggcgcg       600
     cccgcggtcg agtcctccgt tccgccgtcg acctcgtga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page