(data stored in ACNUC7421 zone)

EMBL: CP001630.PE281

CP001630.PE281       Location/Qualifiers
FT   CDS_pept        312083..312202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34255"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34255.1"
FT                   /translation="MTGSTPVFELADDPVLKPTPPDRAAVDRAPAERASVLEG"
     atgacgggca gcacgccggt cttcgagctg gccgacgacc cggtgctcaa gcccacgccc        60
     ccggaccgcg cggccgtgga ccgggcgcct gcggagcgcg cctcggtgct ggaggggtga       120
//

If you have problems or comments...

PBIL Back to PBIL home page