(data stored in ACNUC7421 zone)

EMBL: CP001630.PE282

CP001630.PE282       Location/Qualifiers
FT   CDS_pept        312321..312962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_1732 peptidase M23"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34256"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34256.1"
FT                   /translation="MKHHSAVGALLVAAVALSACSSGPTDPAASPSSGTSSSGASASAS
FT                   SSAAAAPSGDKVTAWVEAYCGLVGGYALGLKAYQEKHVQLPTTTDVAERNKAQLAAFTE
FT                   LVSGLQTDFKAAEGELGKVGVPLSGAEELHGEIIEVLGRVNGQLGQAKQQVAALDPHDP
FT                   DFAQAVSQAGGLEAASALLAHGEKVSGVPELEQAMNTAPKCVEIQRQIGG"
     gtgaagcacc actccgccgt cggggcgctg ctcgtcgccg ccgtcgcgct gtccgcctgc        60
     tcgtccggcc ccaccgaccc ggccgcgtcc ccgtcctcgg ggacctcgtc ctccggggcc       120
     tcggcgtccg cctcgtcctc ggccgccgcc gcgccctcgg gcgacaaggt caccgcgtgg       180
     gtggaggcct attgcggact ggtcggcggt tacgcgctcg gcctcaaggc gtaccaggag       240
     aagcacgtcc agctgccgac cacgaccgac gtggcggagc gcaacaaggc gcaattggcg       300
     gctttcacgg aactcgtctc cgggttgcag acggacttca aggccgccga gggcgagctg       360
     gggaaggtcg gcgtcccgct ctccggggcc gaggagctgc acggcgagat catcgaggtg       420
     ctcggccggg tcaacggcca gctcgggcag gcgaagcagc aggtcgcggc gctcgacccc       480
     cacgaccccg acttcgcgca ggcggtgtcc caggccggtg gcctggaggc cgcgagcgcg       540
     ctgctcgcgc acggcgagaa ggtctccggc gtccccgagc tggagcaggc catgaacacc       600
     gcgccgaagt gcgtcgagat ccagcggcag atcggcggct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page