(data stored in ACNUC7421 zone)

EMBL: CP001630.PE283

CP001630.PE283       Location/Qualifiers
FT   CDS_pept        313088..313771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0D24365p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34257"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34257.1"
FT                   /translation="MKFRVSLVGAALASAAVLSACSSGTAGTASPAGDAPATSSSASPA
FT                   PSGSASAVPTSASAKAGGGDNAKAVSWAGELCATFTGMVDRSLVMLEDVSSEMEKGNLD
FT                   GYRSAVLDYLAGTGTAMSGSLKRLNELGAPTASSAALHAEMVKFLEGVGAESGAAAKKM
FT                   RGLAVTDPAFVEQMGALDQGQGGSDVLLKHLENAEKDPELDLAFATAESCQEMESKLGQ
FT                   MPGSG"
     atgaagttcc gcgtttccct ggtcggcgcc gcgctggcct ccgccgcggt gctctccgcg        60
     tgctcgtccg gcaccgcggg cacggcctcg cccgcgggcg acgccccggc gacctcgtcc       120
     tccgcgtccc ccgcgccctc ggggtccgcc tcggccgtcc cgacctcggc gagcgccaag       180
     gcgggcggcg gtgacaacgc gaaggccgtc agctgggcgg gagagctctg cgccaccttc       240
     accggcatgg tcgaccgcag cctcgtgatg ctcgaggacg tcagctccga gatggagaag       300
     ggcaacctcg acggctaccg gagcgcggtg ctggactacc tcgcgggcac cgggaccgcg       360
     atgtccggct cgctgaagag gctgaacgag ctgggcgcgc ccaccgcgag ctccgccgcg       420
     ctgcacgcgg agatggtcaa gttcctggag ggcgtgggcg cggagtccgg cgccgcggcg       480
     aagaagatgc gggggctggc cgtcaccgac ccggccttcg tggagcagat gggcgcgctc       540
     gaccagggcc agggcgggtc cgacgtgctg ctcaagcacc tggagaacgc cgagaaagac       600
     ccagagctgg acctcgcctt cgccacggcc gagtcgtgcc aggagatgga gtccaagctc       660
     ggccagatgc cggggagcgg ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page