(data stored in ACNUC7421 zone)

EMBL: CP001630.PE284

CP001630.PE284       Location/Qualifiers
FT   CDS_pept        313913..314566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mucin-associated surface protein (MASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34258"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34258.1"
FT                   /translation="MKRHLSVTSVLLSATLALAACDTNTDGAAPASSPAAASAAPASAQ
FT                   VDDGEREARWAASFCTTLGSRAKAAVELMQKMFAQAAEAGENVSEADMQAMQKDLLVEF
FT                   MEDGAKESLDAAKQLEGIGAPAVVGEEFHQKFITLLKTSGDEAAAAVEKVKALDPTSPT
FT                   FEAELDKLSEGGAAETLVAPLQEVGKSKPELNEVLKRTPECVDVVKQMSAIAGK"
     gtgaagcgtc acctgtctgt cacgtctgtg ctgctctccg cgaccctcgc gctcgccgcc        60
     tgcgacacga acaccgacgg cgccgccccc gcgagcagcc ccgctgccgc gtctgcggcc       120
     ccggcctccg cgcaggtcga cgacggcgag cgcgaggcgc gctgggccgc ctccttctgc       180
     accaccctcg gcagccgggc caaggccgcc gtcgagctga tgcagaagat gttcgcgcag       240
     gccgcggagg cgggcgagaa cgtgagcgag gccgacatgc aggccatgca gaaggacctg       300
     ctggtcgagt tcatggagga cggcgcgaag gagagcctcg acgccgcgaa gcagctggag       360
     gggatcggcg cgcccgccgt cgtcggcgag gagttccacc agaagttcat caccctgctg       420
     aagacctccg gcgacgaggc cgccgcggcg gtggagaagg tcaaggcgct cgacccgacc       480
     agccccacct tcgaggccga gctggacaag ctgtccgagg gcggcgccgc cgagacgctg       540
     gtcgcgcccc tgcaggaggt cggcaagagc aagcccgagc tcaacgaggt gctgaagcgg       600
     acccccgagt gcgtggacgt cgtcaagcag atgtccgcga tcgcggggaa gtga             654
//

If you have problems or comments...

PBIL Back to PBIL home page