(data stored in ACNUC7421 zone)

EMBL: CP001630.PE285

CP001630.PE285       Location/Qualifiers
FT   CDS_pept        314696..315328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_0780 branched-chain alpha-keto acid
FT                   dehydrogenase E2 component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34259.1"
FT                   /translation="MGQQLSFYSAEARRPGVDDLAGLLCGPGRVLGFARGRAARLTAVL
FT                   ADPWRGPALVAALAERGVQAESGAPEPVGDPEPPADGQEPGAQPPVQVRTPFRTDLAPL
FT                   AAHWLLAGAKVVPRGFTPHGGVLRLWALTSGRWVEPGYLLGLDPDAPDTHEPLRAALAS
FT                   AGLPAALLTPKSGGPALRVTGRRRLERLSELVGRAPTGVGDRTWPAA"
     gtggggcaac agctgtcctt ctactcggcc gaggcgcggc gaccgggcgt cgacgacctg        60
     gccggcctgc tctgcgggcc gggccgggtg ctcggcttcg ccagggggcg ggccgcccgc       120
     ctcaccgccg tcctcgccga cccctggcgc gggcccgcgc tcgtcgcggc cctcgccgag       180
     cgcggcgtcc aggccgagtc cggcgcgccc gaaccggtcg gcgaccccga gccgccagcg       240
     gacgggcagg agccgggagc ccagcccccg gtgcaggtca ggaccccttt ccggaccgac       300
     ctcgccccgc tcgccgcgca ctggctgctc gcgggcgcca aggtcgtccc gcgcgggttc       360
     accccccacg gcggcgtgct gcggctgtgg gcgctcacct cgggccgctg ggtcgaaccg       420
     ggctacctgc tcggcctcga cccggacgcg ccggacaccc acgaaccgct ccgcgcggcg       480
     ctcgcctcgg ccgggctgcc cgccgcgctg ctcaccccga agtcgggcgg accggctttg       540
     cgggtgaccg gccgaaggcg gttggaacgg ctctccgagc tggtcggacg tgctccgacc       600
     ggggtcgggg accgcacctg gcccgccgct tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page