(data stored in ACNUC7421 zone)

EMBL: CP001630.PE286

CP001630.PE286       Location/Qualifiers
FT   CDS_pept        315457..318228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0291"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: bba:Bd0964 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34260"
FT                   /db_xref="GOA:C6WFC8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC8"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ACU34260.1"
FT                   /translation="MAGSTRTRKSTGGSAGGNRRLVIVESPTKARKIASYLGNGFVVES
FT                   SKGHIRDLPRGAADVPAKYKGQPWARLGVDVDHDFEPLYIVTPDKKSTVAELKELLKGV
FT                   DELYLATDGDREGEAIAWHLLETLKPSVPVRRMVFHEITEPAILAAAASPRDLDLSLVD
FT                   AQETRRILDRLYGYEVSPVLWKKVMPKLSAGRVQSVATRIVVERERERMKFVTASFWDV
FT                   SATIDAGAEATPRQFAGRLVSVDGTRLATGRDFGSDGRLKDGVEVKVLDEAHARAIAEG
FT                   LTGAAMRVASVEEKPYTRKPYPPFMTSTIQQEAGRKLRFSADRTMRAAQKLYENGYITY
FT                   MRTDSTALSETAITAARAQATDLYGAQYVAKEPRQYTRKVKNAQEAHEAIRPAGEVFRT
FT                   PGQVARELDSDEYKLYELIWQRTIASQMADARGNTTSVRVAGRTGGGEDVLFASSGRTI
FT                   TFAGFLKAYVETVDSEAGGNADDAESRLPQLVAEQPVSAAELSADGHSTSPPPRFTEPS
FT                   LIKTMEDLGIGRPSTYASIISTIQDRGYVWKKGSALVPSWVAFAVVGLLEQHFGRLVDY
FT                   DFTAALEDELDGIAEGRQERTTWLSGFYFGGDVGPESSIGRSGGLKKLVGSSVEEIDAR
FT                   EINSIPLFSDEGGHTVVVRVGRYGPYLEREVDGASQRANLPDDLPPDELSLEIAEKLFA
FT                   TPQEGRSLGNDPATGHEIVAKEGRFGPYVTEVLPEPAEGKKAGKPRTSSLFKSMSLDTV
FT                   TLEDALRLLSLPRVVGADPESGAEITAQNGRYGPYLKRGTDSRSLTSEDQLFTVTLDEA
FT                   LKIYAEPKKRGRAAAAPPLKELGNDPVSGKPMVVKEGRFGPYVTDGETNASLRKSDNVE
FT                   TLSDERGSELLAEKRAKGPSTKKKPAARTTKAAAKPAAKKPAAKKTPAKSKG"
     gtggctggat cgacgcggac gaggaagagc accgggggaa gtgcgggcgg caaccggcgg        60
     ttggtgatcg tcgagtcgcc caccaaggcg cgcaagatcg cgtcctacct cggcaacggc       120
     ttcgtcgtgg agtcgtccaa ggggcacatc cgggacctgc cgcgcggcgc ggccgacgtg       180
     cccgccaagt acaaggggca gccctgggcg cggctcggcg tggacgtcga ccacgacttc       240
     gagccgctct acatcgtcac cccggacaag aagtcgaccg tcgccgagct caaggagctg       300
     ctcaagggcg tcgacgagct ctacctcgcg acggacggcg accgcgaggg cgaggcgatc       360
     gcctggcacc tgctggagac cctcaagccc tcggtcccgg tgcgccgcat ggtgttccac       420
     gagatcaccg agcccgcgat cctcgccgcc gccgccagcc cgcgcgacct ggacctgagc       480
     ctggtcgacg cgcaggagac ccgccgcatc ctggaccgcc tctacggcta cgaggtcagc       540
     cccgtgctgt ggaagaaggt catgccgaag ctgtcggcgg gccgcgtcca gtcggtggcc       600
     acccgcatcg tggtcgagcg cgagcgcgag cggatgaagt tcgtgaccgc ctcgttctgg       660
     gacgtctcgg cgaccatcga cgcgggcgcc gaggccaccc cgcgccagtt cgcgggcagg       720
     ctcgtctccg tcgacggcac caggctcgcc accggccgcg acttcggctc ggacggccgc       780
     ctcaaggacg gcgtcgaggt caaggtgctg gacgaggcgc acgcccgcgc catcgccgag       840
     ggcctgaccg gcgcggccat gcgcgtggcc tccgtcgagg agaagcccta cacgcgcaag       900
     ccgtacccgc cgttcatgac ctccacgatc cagcaggagg cgggccgcaa gctgcgcttc       960
     tccgccgacc gcacgatgcg ggccgcgcag aagctgtacg agaacggcta catcacctac      1020
     atgcgaaccg acagcaccgc gctgtcggag accgccatca ccgcggcccg cgcccaggcc      1080
     accgacctgt acggcgcgca gtacgtggcc aaggagcccc ggcagtacac ccgcaaggtc      1140
     aagaacgccc aggaggcgca cgaggccatc cgcccggcgg gcgaggtctt ccgcaccccc      1200
     ggccaggtgg cccgcgagct ggactccgac gagtacaagc tctacgagct gatctggcag      1260
     cgcaccatcg cctcccagat ggccgacgcg cgcggcaaca ccacgagcgt gcgcgtcgcg      1320
     ggccgcacgg gcggcggcga ggacgtgctg ttcgcctcct ccggccgcac gatcacgttc      1380
     gcgggcttcc tcaaggcgta cgtggagacg gtcgactcgg aggcgggcgg caacgccgac      1440
     gacgccgagt cccggctgcc gcagctggtc gccgagcagc cggtgagcgc cgccgagctg      1500
     tccgccgacg gccactcgac ctcgccgccg ccgcgcttca ccgagcccag cctgatcaag      1560
     accatggagg acctgggcat cggccgcccg tccacctacg cgtcgatcat cagcaccatc      1620
     caggaccgcg gctacgtgtg gaagaagggc tccgcgctgg tgccctcctg ggtggcgttc      1680
     gcggtggtcg ggctgctgga gcagcacttc ggcaggctgg tcgactacga cttcaccgcc      1740
     gcgctggagg acgagctcga cggcatcgcc gagggccgcc aggagcgcac cacctggctg      1800
     tccggcttct acttcggcgg cgacgtcggc cccgagtcct cgatcggccg ctccggcggg      1860
     ctcaagaagc tggtcggctc cagcgtcgag gagatcgacg cccgcgagat caactcgatc      1920
     ccgctgttca gcgacgaggg cgggcacacc gtcgtggtcc gggtcggccg gtacgggccg      1980
     tacctggagc gcgaggtcga cggcgcgtcg cagcgggcga acctgcccga cgacctgccg      2040
     ccggacgagc tgagcctgga gatcgcggag aagctgttcg cgaccccgca ggagggccgc      2100
     tcgctgggca acgacccggc gaccgggcac gagatcgtgg ccaaggaggg ccgcttcggg      2160
     ccgtacgtca ccgaggtgct gcccgagccc gccgagggca agaaggccgg gaagcctcgc      2220
     accagctcgc tgttcaagtc gatgtcgctg gacaccgtga cgctggagga cgcgctgcgg      2280
     ctgctgtccc tgccgcgcgt ggtcggcgcc gacccggagt ccggcgcgga gatcaccgcg      2340
     cagaacggcc ggtacgggcc gtacctcaag cgcggcaccg actcgcggtc gctgaccagc      2400
     gaggaccagc tgttcacggt gaccctggac gaggcgctga agatctacgc cgagcccaag      2460
     aagcgcggtc gcgccgcggc ggccccgccg ctcaaggagc tgggcaacga cccggtgtcc      2520
     ggcaagccga tggtggtcaa ggagggccgc ttcggcccgt acgtcaccga cggcgagacc      2580
     aacgcctcgc tgcgcaagtc ggacaacgtg gagacgctgt ccgacgagcg gggctccgag      2640
     ctgctggcgg agaagcgggc caaggggccg agcacgaaga agaagccggc ggccaggacg      2700
     acgaaggccg ccgcgaagcc cgcggcgaag aagcccgccg cgaagaagac cccggcgaag      2760
     tcgaagggct ga                                                          2772
//

If you have problems or comments...

PBIL Back to PBIL home page