(data stored in ACNUC7421 zone)

EMBL: CP001630.PE287

CP001630.PE287       Location/Qualifiers
FT   CDS_pept        318252..318821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34261"
FT                   /db_xref="GOA:C6WFC9"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34261.1"
FT                   /translation="MDGGLFGPDGTQAPPPPAAFPDPLAGLVTGELPWALPAPEVRAAE
FT                   VRAAAPLAPPAAVTPQRAARPTGAGGRPQAGRARTGQRAPQAPRPAVPHPPVPYPPASY
FT                   PPVPHPTAPYPQVPHPQLQHPAPPRRQVPGLRAQRGPAAPAQPAEALAKGTGSTVVGIL
FT                   VVLGVIASILFTTLREVVGELLDLLR"
     gtggacggcg ggctgttcgg accggacggc acgcaggccc cgccgccgcc cgccgcgttc        60
     cccgacccgc tcgccgggct ggtcaccggc gagctgccct gggcgctgcc cgcgcccgag       120
     gtccgggccg ccgaggtccg ggccgccgcg ccgctcgcgc ctcccgctgc cgtgacgccc       180
     cagcgggcgg cgcgcccgac cggggcgggc gggcgtccgc aggccggtcg cgccaggacc       240
     ggtcagcggg cgccgcaggc cccgcgcccg gccgtcccgc acccgcctgt cccgtatccg       300
     cctgcctcgt acccgcctgt cccgcacccg acggcgccgt acccgcaggt cccgcacccg       360
     cagctccagc accccgcgcc cccgcgcagg caggtccccg gcctgcgcgc ccagcgcggg       420
     cccgccgccc ccgcccagcc cgccgaggcc ctggcgaagg gcacgggcag cacggtcgtc       480
     ggcatcctgg tcgtcctcgg cgtcatcgcc tccatcctgt tcaccacgct gcgcgaggtc       540
     gtcggcgagc tgctcgacct cctgcgctga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page