(data stored in ACNUC7421 zone)

EMBL: CP001630.PE288

CP001630.PE288       Location/Qualifiers
FT   CDS_pept        318901..321033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0293"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1;
FT                   thymidylate kinase; KEGG: eli:ELI_06215 thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34262"
FT                   /db_xref="GOA:C6WFD0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFD0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34262.1"
FT                   /translation="MSTIQDSDTAGGPGRSGSNRTEASTGHRIRSVLAIRPFRRLWGVT
FT                   YLCSVGDWLSLLALTGLVTKLAEGYRWEGFALSAVVITQLLPGMLFAPLGGVLADRFDR
FT                   RKVMVACDLARGALFLSIAFVGTAWWLFIANFLIGCCAMLWIPAKDSAVPNLLRRPDQV
FT                   ETANQLGLVMTYGITTISGFGLYALISGIPGYFHLQGGDLSFRIATIAVVVNGLLYVSS
FT                   AVLVATRIPELSGRMATPRKRDDDAPGFLVMMRDGLSYAWHRPLLRGLVIGMTGAFAAA
FT                   GAVIGSAKLYALSLLGGESAYGLLFIAVFAGLATGMITAPKLARRLTHGRLFGVTIVCA
FT                   GLSLGVVSLAPHLWFALVAVALVGGCAGIAFLTGLTIIGSKVEDEVRGRMVALVQSLMK
FT                   VILGLSTVASPLLVTTLQPRVITVLDHPLKIDGTRPVLFGAGVLAAAVGLIAYRLMDDR
FT                   RETPILSDLLAALRGRPRRERGLLITVEGDASLDTSVQARELAEVLRSAGHEVLLASEP
FT                   DLDERRVHELLNTADLAGVRAHALVAAAVRADVVERRVRPALEAGLIVVVDRFADSPIA
FT                   HFSASGSVDTSELERLSDWATGRLRPDLTVLLDRTPTTLPASALGAPPGAVPAGTAPPG
FT                   AASAGLEGARRTITHVEHHWQVQRLLTGMAAADPDRYLVVDADGTPDEVAARVKAAVAR
FT                   LVGGEIRAAAPLAETP"
     gtgagcacca tccaggacag cgacacggct ggtgggccgg gacgatccgg gagcaaccgg        60
     accgaggcgt ccaccgggca tcgcatccgg agcgtgttgg ccatccgccc cttccgcagg       120
     ctctggggcg tcacctacct ctgcagcgtg ggtgactggc tgtcactcct ggcgctgacg       180
     ggtctggtca ccaagctcgc cgagggctac cgctgggagg gcttcgcgct cagcgcggtc       240
     gtcatcaccc agctgctgcc ggggatgctc ttcgccccgc tcggcggcgt cctcgccgac       300
     cggttcgacc gccgcaaggt catggtcgcc tgcgacctgg cgcgcggcgc gctgttcctg       360
     tccatcgcct tcgtcggcac cgcctggtgg ctgttcatcg cgaacttcct catcggctgc       420
     tgcgcgatgc tgtggatccc cgccaaggac tcggcggtgc ccaacctgct gcgcaggccc       480
     gaccaggtgg agaccgccaa ccagctcggc ctggtgatga cctacggcat caccaccatc       540
     agcgggttcg gcctctacgc gctcatctcc ggcatccccg gctacttcca cctgcagggc       600
     ggcgacctca gcttccgcat cgccaccatc gccgtggtgg tcaacggcct gctctacgtc       660
     tcgtcggcgg tcctggtcgc cacccgcatc cccgagctgt ccggccgcat ggccacgccc       720
     cgcaagcgcg acgacgacgc ccccggcttc ctcgtgatga tgcgcgacgg cctgtcctac       780
     gcctggcacc gcccgctgct gcgcggcctg gtcatcggca tgaccggcgc gttcgcggcg       840
     gcgggcgcgg tcatcggcag cgccaagctg tacgcgctga gcctgctcgg cggggagagc       900
     gcctacggcc tgctgttcat cgcggtcttc gcgggcctgg ccacgggcat gatcaccgcc       960
     cccaagctcg cccgcaggct cacccacggc aggctgttcg gcgtcaccat cgtctgcgcc      1020
     ggcctgagcc tgggcgtggt gtcgctggcc ccgcacctgt ggttcgccct ggtcgcggtc      1080
     gccctggtcg gcggctgcgc gggcatcgcg ttcctgaccg gcctcaccat catcggctcc      1140
     aaggtcgagg acgaggtgcg cggccggatg gtcgccctgg tccagtccct gatgaaggtc      1200
     atcctgggcc tgtccaccgt ggccagcccg ctgctggtca ccaccctgca gcccagggtc      1260
     atcaccgtcc tcgaccaccc gctcaagatc gacggcaccc gcccggtgct gttcggcgcg      1320
     ggtgtcctgg ccgccgccgt cggcctgatc gcctaccggc tcatggacga ccggcgcgag      1380
     accccgatcc tgtccgacct gctcgccgcg ctgcgcggca ggccccgccg ggagcgcggc      1440
     ctgctcatca ccgtggaggg cgacgccagc ctggacacct cggtgcaggc ccgcgagctg      1500
     gccgaggtgc tgcgctccgc cgggcacgag gtgctgctgg ccagcgagcc cgacctggac      1560
     gaacgccggg tgcacgagct gctcaacacc gccgacctgg ccggggtgcg ggcgcacgcg      1620
     ctggtggccg ccgccgtgcg cgccgacgtg gtcgagcggc gcgtgcggcc cgcgctggag      1680
     gccgggctga tcgtcgtcgt ggaccggttc gccgacagcc cgatagcgca cttctccgcc      1740
     tccggctccg tcgacacctc cgagctggag cggctgtccg actgggccac cggcaggctc      1800
     cgccccgacc tgaccgtgct gctcgaccgc acccccacca cgctgcccgc ctccgcgctc      1860
     ggcgcgcccc ccggagcagt gcccgccgga accgcgcccc caggagccgc gtccgccggg      1920
     ttggagggcg cccgccgcac gatcacccac gtcgagcacc actggcaggt gcagcgcctg      1980
     ctcaccggca tggccgccgc cgaccccgac cgctacctcg tggtcgacgc cgacggcacc      2040
     ccggacgagg tggccgcgcg ggtcaaggcc gccgtggcgc gcctggtcgg cggcgagatc      2100
     cgcgctgccg ctccgctcgc cgagaccccc tga                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page