(data stored in ACNUC7421 zone)

EMBL: CP001630.PE289

CP001630.PE289       Location/Qualifiers
FT   CDS_pept        321047..322246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0294"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dal:Dalk_0024 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34263"
FT                   /db_xref="GOA:C6WFD1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFD1"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ACU34263.1"
FT                   /translation="MPRGVWSEVVGQPDAVTVLSAAAEAAAAIVAGGTPAPGAMTHAWL
FT                   FTGPPGSGRTEAARAFAGALQCTAADDRPGCGVCAGCHTALAGTHADVRVVAPEGLSIS
FT                   VNEMRALVQVSARRPTSGRWQVVIVADADRLTEGASNALLKAVEEPPDRTVFLLCAPSE
FT                   HPYDVSVTIRSRCRVVRLGSPKVPDVAAALEEEGVAPDLASWSASVTGGNVVRARRLAT
FT                   DEQSRLRRESVLAIPLALRRPADVFTCADDLVKAAEGDALSANEDRDEQERKALETAMG
FT                   AGGTGKGTASATRGAKGALKDLEKRQKSRATRTQRDSLDQALVDLAAFYRDVLVTATGS
FT                   EAALNHPDRAADARTAAAAWSRESTLRRLEAVLACRGALERNVKPRIAVEAMLTTLQRG
FT                   "
     gtgccaaggg gagtgtggag tgaggtcgtc ggccagcccg acgcggtgac cgtgctcagc        60
     gccgcggcgg aggcggccgc ggcgatcgtc gcgggtggga cgcccgcgcc gggggccatg       120
     acgcacgcct ggctgttcac cgggccgccc ggatcgggcc gcaccgaggc agccagggcg       180
     ttcgccgggg ccctgcagtg caccgccgcc gacgaccggc ccggctgcgg cgtgtgcgcg       240
     ggctgccaca ccgcgctcgc gggcacccac gccgacgtgc gcgtggtcgc ccccgagggc       300
     ctgtcgatct cggtgaacga gatgcgcgcg ctggtgcagg tgtccgcccg caggcccacc       360
     tcgggccgct ggcaggtggt gatcgtcgcc gacgccgacc ggctcaccga gggcgcgtcg       420
     aacgcgctgc tcaaggccgt ggaggagccg ccggaccgca ccgtgttcct gctctgcgcg       480
     ccctccgagc acccgtacga cgtgtcggtg accatccgct cgcgctgccg cgtggtgcgg       540
     ctgggctccc cgaaggtccc ggacgtggcc gccgcgctgg aggaggaggg cgtcgccccc       600
     gacctcgcgt cctggtccgc gtcggtgacc ggcggcaacg tggtcagggc ccgcaggctc       660
     gccaccgacg agcagagcag gctgcgccgc gagtccgtgc tggccatccc gctcgcgctg       720
     cgcaggcccg ccgacgtgtt cacctgcgcc gacgacctgg tgaaggccgc cgagggcgac       780
     gcgctgtccg ccaacgagga ccgcgacgag caggagcgca aggcgctgga gaccgccatg       840
     ggcgcgggcg gcaccggcaa gggcaccgcc tcggccacca ggggcgccaa gggcgcgctc       900
     aaggacctgg agaagcggca gaagtccagg gccacccgga cccagcggga ctcgctcgac       960
     caggcgctgg tggacctggc cgcgttctac cgggacgtgc tggtcaccgc gaccggctcc      1020
     gaggccgcgc tgaaccaccc ggaccgcgcg gcggacgccc ggacggcggc ggcggcctgg      1080
     agccgtgagt cgacgctgcg cagacttgaa gcagtgctgg cgtgtcgggg agcgctggag      1140
     cggaacgtga agccgaggat cgccgtggag gcgatgctga cgaccctgca gcggggctga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page