(data stored in ACNUC7421 zone)

EMBL: CP001630.PE29

CP001630.PE29        Location/Qualifiers
FT   CDS_pept        32468..33103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0029"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   xca:xccb100_0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34003"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI2"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACU34003.1"
FT                   /translation="MRLVIAGGHGKIALHVQRLLAAGGDAATALVRNEDHFADVTEAGG
FT                   VPVLCDLEASDVASVAEYLTGADAVLFAAGAGPGSGVGRKDSVDRGASALLADAAERAG
FT                   VRRFVQISSAGIGRTTGDEVFDAYLLAKGAAEEDLKARDLDWTIVRPGRLTDEPATGAV
FT                   RLTEGDAQDGSVPRADVAAVVVAVLAQPSSVGKTYELISGETPVQDAI"
     atgaggcttg tgatcgcggg agggcacggg aagatcgcgc tgcacgtcca gcggctgctg        60
     gcggccggcg gggacgcggc caccgcgctg gtccgcaacg aggaccactt cgcggacgtg       120
     accgaggcgg gcggggtgcc ggtgctgtgc gacctggagg cgagcgatgt cgcctcggtc       180
     gccgagtacc tgaccggcgc ggacgcggtg ctgttcgccg cgggcgccgg gcccggcagc       240
     ggggtggggc gcaaggacag cgtggaccgg ggagcctccg cgctcctggc ggacgccgcc       300
     gagcgggcgg gcgtgcgcag gttcgtgcag atcagctcgg cgggcatcgg ccggaccacc       360
     ggcgacgagg tgttcgacgc ctacctgctc gccaagggcg cggccgagga ggacctgaag       420
     gcccgcgacc tggactggac gatcgtccgg cccggcaggc tgaccgacga gcccgcgacc       480
     ggcgcggtcc ggctcaccga gggggacgct caggacgggt ccgtgccgcg cgccgacgtg       540
     gccgccgtgg tcgtggcggt gctggcgcag ccgtcgtcgg tcgggaagac ctacgagctg       600
     atctccggcg agaccccggt ccaggacgcg atctag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page