(data stored in ACNUC7421 zone)

EMBL: CP001630.PE290

CP001630.PE290       Location/Qualifiers
FT   CDS_pept        322756..323649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0295"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   dal:Dalk_4823 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34264"
FT                   /db_xref="GOA:C6WGE8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGE8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34264.1"
FT                   /translation="MRRPDTTDAVVDVAPSRRTVRRPRSVSVVVTAHGLEPTAGVVVED
FT                   ALRGLEELGVPGEVVVVVGRADRTAQVALTAGASVVESRPGRGAAVLAGVAASRGDVVC
FT                   LLDGDVRYFGDPPLVPLLVEPILGGLADACVSDLYWRPPHPRLWLHGFFAPLIGRVYPE
FT                   LLPRAGSTPWSGQRAALRALWPAELPDGATADLALLLHWNREAALLRPVLADDWTAPGR
FT                   PRLEPSRADLDLVVADALAHGRIDETGAKALPDWFEAVQSGAGERWGDVVDPVDFAAAE
FT                   RDVLEEALRELRAHGL"
     gtgcgccgac ctgacacgac cgacgcggtg gtcgacgtcg cgccgagccg caggacggtc        60
     cgcaggcccc gcagcgtgag tgtcgtcgtc accgcgcacg gcctggagcc caccgcgggc       120
     gtcgtggtcg aggacgcgct gcgcgggctg gaggagctcg gggtgcccgg cgaggtcgtg       180
     gtcgtggtcg ggcgcgccga ccgcaccgcc caggtcgccc tcaccgcggg ggcctcggtg       240
     gtcgagtcgc ggccgggccg gggcgcggcg gtcctcgcgg gcgtggcggc cagccggggc       300
     gacgtggtgt gcctgctcga cggggacgtg cgctacttcg gcgacccgcc gctggtgccg       360
     ctgctggtcg agccgatcct gggcggcctc gccgacgcct gcgtgagcga cctgtactgg       420
     cgcccgccgc acccccggct gtggctgcac gggttcttcg cgccgctgat cggccgggtg       480
     tacccggagc tgctgcccag ggccgggtcg acgccctggt cggggcagcg ggccgcgctg       540
     cgcgccctgt ggcccgccga gctgccggac ggggccaccg ccgacctcgc gctgctgctg       600
     cactggaacc gggaggcggc gctgctgcgc ccggtgctgg ccgacgactg gaccgcgccg       660
     ggcaggccga ggctggagcc ctcgcgcgcg gacctggacc tggtcgtcgc ggacgcgctg       720
     gcgcacgggc ggatcgacga gaccggggcg aaggcgctgc cggactggtt cgaggccgtc       780
     cagtcgggcg cgggggagcg ctggggcgac gtggtcgacc cggtggactt cgccgccgcc       840
     gagcgggacg tgctggagga ggccctgcgc gagctgcgcg cgcacgggct gtga             894
//

If you have problems or comments...

PBIL Back to PBIL home page