(data stored in ACNUC7421 zone)

EMBL: CP001630.PE292

CP001630.PE292       Location/Qualifiers
FT   CDS_pept        complement(325736..326707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0297"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bcb:BCB4264_A4636 iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34266"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF0"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACU34266.1"
FT                   /translation="MRLLTPALLAAAVLLSACGTTESTSSEPSASGDAGGAITLTDARG
FT                   KTVELKAPAKKVVSLEWAETEMVLTLGVTPVGAADPEGYATWNAAEALPGDVKDVGKRG
FT                   EPSVDAIVALEPDLVLMPLARDTAVAEQLEKAVPVVMTKSSDATKNFDRLREDFTLIAK
FT                   AVGKEAEAKTALAEMDAKLAEGKKAVEAKGATGTPFVMADGWMQGSTVSIRPFGKGSLV
FT                   SDTAEAVGLVNAWTGEVDAEWGLGATDVEGMTAITDPKTIMVYSASEEDVFTTGLKDNA
FT                   VWQRLPFTASGKITKLEKGTWTFGGPKSVAVIADQFVKAATS"
     atgcgcctgt tgacccccgc cctgctcgcg gcagccgtgc tgctgtccgc ctgcggcacc        60
     accgagagca cctccagcga gcccagcgcg tccggtgacg ccggtggcgc catcacgctg       120
     accgacgcgc gcggcaagac cgtcgagctg aaggcccccg cgaagaaggt cgtgtccctg       180
     gagtgggccg agaccgagat ggtgctgacg ctgggggtca ccccggtcgg cgccgccgac       240
     cccgagggct acgcgacctg gaacgcggcc gaggcgctgc ccggtgacgt gaaggacgtc       300
     ggcaagcgcg gcgagcccag cgtcgacgcg atcgtggcgc tggagccgga cctggtgctg       360
     atgccgctgg cccgcgacac cgccgtggcc gagcagctgg agaaggccgt cccggtcgtc       420
     atgaccaagt ccagcgacgc cacgaagaac ttcgaccggc tgcgcgagga cttcaccctg       480
     atcgccaagg ccgtgggcaa ggaggccgag gcgaagaccg cgctggccga gatggacgcg       540
     aagctcgccg agggcaagaa ggccgtcgag gccaagggcg cgaccggcac cccgttcgtc       600
     atggcggacg gctggatgca gggcagcacg gtcagcatcc gcccgttcgg caagggctcg       660
     ctggtgtccg acaccgccga ggcggtcggc ctggtcaacg cgtggaccgg cgaggtcgac       720
     gcggagtggg gtctgggcgc gaccgacgtc gagggcatga ccgcgatcac cgacccgaag       780
     acgatcatgg tctacagcgc ctccgaggag gacgtgttca ccaccggcct caaggacaac       840
     gcggtgtggc agcggctgcc gttcacggcc tccggcaaga tcaccaagct ggagaagggc       900
     acctggacgt tcggcgggcc caagtcggtc gccgtcatcg cggaccagtt cgtgaaggcc       960
     gcaacgtcct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page