(data stored in ACNUC7421 zone)

EMBL: CP001630.PE293

CP001630.PE293       Location/Qualifiers
FT   CDS_pept        complement(326738..327556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0298"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ent:Ent638_1120 iron-enterobactin transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34267"
FT                   /db_xref="GOA:C6WGF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34267.1"
FT                   /translation="MSQGDALLTGEALVLAHHDRAVVEGVSLELRAGEVTALVGPNGSG
FT                   KSTVLRSLARLHKPREGGVRLGERQVWGRAALSGKEFARNVTLLTQHRPTPSGVSVRDV
FT                   VSYGRHPHRAGWRGVDAGGAAAVERAMELTGVTPMAGRGVDELSGGELQRVWLASCLAQ
FT                   ETSVLLLDEPTNHLDLRYQVEVLDVVRDLADDHGVAVGVVLHDLDHAGVVADEVVLLCD
FT                   GRVVASGAVRDVLTADHLTSAYGVEVQVVDDPVTGAPHCRPLGKRTQRRP"
     atgtcacaag gcgacgctct gctcaccggt gaggcgctgg tcctcgcgca ccacgaccgc        60
     gccgtggtgg agggcgtgtc cctggagctg cgcgcgggcg aggtcaccgc gctggtcggt       120
     cccaacggct cgggcaagtc caccgtgctg cgctcgctcg cgcgcctgca caagccccgc       180
     gagggcggcg tgcggctcgg cgagcggcag gtgtgggggc gggcggcgct cagcggcaag       240
     gagttcgccc gcaacgtcac cctgctcacc cagcaccgcc ccaccccgtc cggcgtgtcc       300
     gtgcgcgacg tcgtctccta cggccgccac ccgcaccgcg cgggctggcg cggggtggac       360
     gcgggcgggg ccgccgccgt cgagcgggcc atggagctga ccggcgtcac ccccatggcg       420
     ggccggggcg tcgacgagct gtccggcggc gagctgcagc gcgtctggct ggcgtcctgc       480
     ctggcgcagg agacctccgt gctgctgctc gacgagccca ccaaccacct ggacctgcgc       540
     taccaggtcg aggtgctgga cgtggtccgc gacctggccg acgaccacgg cgtggcggtc       600
     ggcgtcgtgc tgcacgacct cgaccacgcc ggtgtggtcg ccgacgaggt ggtcctgctg       660
     tgcgacggcc gcgtcgtcgc ctccggcgcg gtgcgcgacg tgctcaccgc ggaccacctg       720
     accagcgcgt acggcgtcga ggtccaggtc gtcgacgacc cggtcaccgg ggccccgcac       780
     tgccgtccgc tcggcaagcg gacgcaacgc agaccctga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page