(data stored in ACNUC7421 zone)

EMBL: CP001630.PE295

CP001630.PE295       Location/Qualifiers
FT   CDS_pept        complement(328149..329243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0300"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   swi:Swit_1615 coenzyme F420-dependent N5 N10- methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34269"
FT                   /db_xref="GOA:C6WGF3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019919"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF3"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU34269.1"
FT                   /translation="MTPAVGSGVRGSSEPTAVLSPSPTSRPDPAADWTWPPHPRTTGPV
FT                   LVDQVEVEYTPTTVVEAARAAEEAGIDGFWVAETRHDPFVALGRVADRVERVGLGTAIA
FT                   VAFARNPMSTAVQANDLQLLSRGRFRLGLGSQVEQHITKRFGMPWSRPAARMREYVLAM
FT                   RAIWESWATGERPRFRGEFSTHTLMTPFFDPGPNPFGPPEVWLAGVGERMTEVAGEVAD
FT                   GFLCHAFTTERYLREVTLPALERGLAKSGRTLEGFGVSGPSMVVTDDASAAAVRRQIAF
FT                   YGSTPAYRPVLDLHGWGELHEELHRLSRRGLWAEMDAAVPDEVLGAFAVTGTPAEAAAE
FT                   VVARYGDVVTRIAAPVLRADLRSG"
     gtgacccccg ccgtgggctc cggcgtccgg gggtcgtcgg agcccacggc ggtcctgtcc        60
     ccctccccca cttcccgacc ggacccggcc gccgactgga cctggccgcc gcacccgcgt       120
     acaaccggtc ccgtgctggt ggatcaggtc gaggtcgagt acacccccac gacggtcgtc       180
     gaggcggcgc gcgccgccga ggaggccggg atcgacgggt tctgggtcgc cgagacccgg       240
     cacgacccgt tcgtggcgct gggcagggtc gccgaccggg tcgagcgggt cggcctgggc       300
     accgccatcg cggtcgcctt cgcccgcaac ccgatgagca ccgccgtcca ggccaacgac       360
     ctgcagctgc tgtcgcgggg ccggttccgg ctgggcctcg gctcgcaggt ggagcagcac       420
     atcaccaagc ggttcgggat gccctggtcg aggcccgccg cgcggatgcg cgagtacgtg       480
     ctggcgatgc gcgccatctg ggagtcgtgg gccaccgggg agcgcccccg gttccggggc       540
     gagttctcca cgcacacgct gatgacgccg ttcttcgacc ccggccccaa cccgttcggc       600
     ccgcccgagg tgtggctggc cggggtcggg gagcggatga ccgaggtcgc gggcgaggtg       660
     gccgacgggt tcctgtgcca cgccttcacc accgagcggt acctgcgcga ggtgacgctg       720
     cccgcgctgg agcgggggct ggcgaagtcc gggcggacgc tggaggggtt cggcgtgagc       780
     gggccgtcga tggtggtcac cgacgacgcg tcggccgccg ccgtccgccg ccagatcgcg       840
     ttctacggct cgacgcccgc ctaccgcccg gtgctggacc tgcacggctg gggcgagctg       900
     cacgaggagc tgcaccggct gtcccgcagg ggcctgtggg ccgagatgga cgccgccgtg       960
     ccggacgagg tgctgggcgc gttcgccgtc accgggaccc ccgcggaggc cgccgccgag      1020
     gtcgtggcgc ggtacgggga cgtggtcacc cggatcgcgg ccccggtgct gcgcgcggac      1080
     ctcaggtccg gctga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page