(data stored in ACNUC7421 zone)

EMBL: CP001630.PE296

CP001630.PE296       Location/Qualifiers
FT   CDS_pept        complement(329240..329704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0301"
FT                   /product="Excalibur domain protein"
FT                   /note="PFAM: Excalibur domain protein; KEGG: GE20613 gene
FT                   product from transcript GE20613- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34270"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF4"
FT                   /inference="protein motif:PFAM:PF05901"
FT                   /protein_id="ACU34270.1"
FT                   /translation="MRSESNTRLSAPAPGRGGKVVCGFLVVLTALVLAGCEGSAPAGGQ
FT                   VSTSPSPTTTTTSATTTTSSPAPVTTTSTTTTTTTPPPAVAPPPQPNPQPAPNPQPAPN
FT                   PQPAPEPKPAPSAYYKNCAEARAAGAAPLHAGEPGYRTGLDRDGDGVACE"
     gtgagaagtg agtcgaacac caggctgtcc gctcccgcgc ccggtcgggg tggcaaggtc        60
     gtctgcgggt tcctggtggt gctgacggcg ctcgtgctgg cgggctgcga ggggagcgca       120
     ccggccgggg gccaggtgtc cacgagcccc tcgccgacca ccacgaccac gagcgcgacc       180
     accacgacca gcagcccggc gccggtcacc acgaccagca cgacgacgac caccaccacg       240
     ccgccgcccg ccgtcgcgcc gccgccgcag ccgaacccgc agcccgcgcc gaacccgcag       300
     cccgcgccca acccccaacc cgcgccggag cccaagcccg cgccgagcgc ctactacaag       360
     aactgcgccg aggcgcgtgc cgcaggcgcc gcgcccctgc acgcgggcga gccgggctac       420
     cgcaccggcc tcgaccggga cggggacggc gtggcctgcg agtga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page