(data stored in ACNUC7421 zone)

EMBL: CP001630.PE297

CP001630.PE297       Location/Qualifiers
FT   CDS_pept        complement(329694..330653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0302"
FT                   /product="Excalibur domain protein"
FT                   /note="PFAM: Excalibur domain protein; KEGG: sal:Sala_0134
FT                   excalibur"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34271"
FT                   /db_xref="GOA:C6WGF5"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF5"
FT                   /inference="protein motif:PFAM:PF05901"
FT                   /protein_id="ACU34271.1"
FT                   /translation="MSANHGNDQNGGAPGYGVPDDNAGYGTPGYGVPGYGAPDYGYGPQ
FT                   ATAYTPPPQAKSGLKGKWSAMSRMKKTGTVAGGIFVALILIGALGDPPPADSTRAAATA
FT                   SATATTTSTTTTTTTAPTTTTPPPVTVAEVADGRSVAVAGGRVLVLAGLAQPGECWAQQ
FT                   AVDFLKSTVAGKELAQVGGQLLLPDGSDVSLLALSQGVAKALPEASAAHNAAQAAAQKA
FT                   GLGLWGAPCGGSDAKPAPTTTTQAPAPQPNPQPNPQPQPNPQPNPQPAPQPEPQPAPSA
FT                   YYANCAAVKAAGAAPLYAGSPGYSSKLDRDGDGVACEK"
     atgagcgcca accacggcaa cgaccagaac ggcggcgcgc ccggctacgg cgtccccgac        60
     gacaacgcgg gctacggcac gcccggctac ggcgttcccg gctacggggc gcccgactac       120
     ggctacggcc cccaggccac cgcctacacc ccgccgccgc aggccaagag cggtctgaag       180
     ggcaagtggt cggcgatgtc gcgcatgaag aagaccggca cggtggcggg cgggatcttc       240
     gtcgccctga tcctgatcgg cgcgctcggc gacccgccgc ccgccgacag caccagggcg       300
     gcggcgaccg cgagcgccac cgcgaccacc accagcacca cgacgaccac cacgacggcc       360
     ccgaccacca cgacgcctcc cccggtgacg gtggccgagg tggcggacgg ccgctcggtc       420
     gcggtcgcgg gcgggcgggt gctggtgctg gccgggctgg cccagccggg cgagtgctgg       480
     gcgcagcagg cggtggactt cctcaagtcg accgtggcgg gcaaggagtt ggcgcaggtc       540
     ggcggtcagc tgctgctgcc ggacggcagc gacgtgtccc tgctcgcgct gtcccagggg       600
     gtggcgaagg cgctgccgga ggcgagcgcc gcgcacaacg cggcccaggc ggcggcccag       660
     aaggcgggcc tcggcctgtg gggcgcgccc tgcggcggtt cggacgccaa gcccgccccg       720
     acgaccacca cgcaggcccc ggctccccag ccgaaccccc agcccaaccc gcagccgcag       780
     cccaacccgc agcccaaccc ccagcccgcg ccccagccgg agccccagcc cgcaccgagc       840
     gcctactacg cgaactgcgc ggcggtgaag gccgcgggcg cggcgccgct gtacgccggg       900
     tcccccggct actcgtccaa gctggaccgc gacggtgacg gggtggcctg tgagaagtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page